DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss29

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:275 Identity:87/275 - (31%)
Similarity:127/275 - (46%) Gaps:36/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLC---------AAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR------RRGSHTCGGSI 57
            |:.||         .||..|.....|...||||..|.:|::|.|:|||      ....|.|||||
Mouse     2 LIQLCLTLFFLGCSIAGTPAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSI 66

  Fly    58 ISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLR 120
            |...:|:|||||:::.:  |..:...|:.|...|..|...:.|:.|.:||::  ...|.|||:|:
Mouse    67 IHPQWVLTAAHCIRERD--ADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQ 129

  Fly   121 LRNSLTFNSNIAAIKLATE--DPPNDATVDISGWGAISQRG--PISNSLLYVQVKALSRESCQKT 181
            |..|:....|:..:||.:|  :........::||||:|...  |....|..||||.:....|::.
Mouse   130 LAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEM 194

  Fly   182 YL---------RQLPETTMCLLHPKDKGACYGDSGGP----ATYQGKLVGLASFVIGGCGRAAPD 233
            |.         ::|....|.....:.:.:||||||||    .|....|||:.|:..|...|..|.
Mouse   195 YHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPG 259

  Fly   234 GYERVSKLRNWIAEK 248
            .|.||.....||.::
Mouse   260 VYARVQSFLPWITQQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/242 (32%)
Tryp_SPc 28..248 CDD:238113 80/244 (33%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 80/244 (33%)
Tryp_SPc 31..271 CDD:214473 78/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.