DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Prss28

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:246 Identity:72/246 - (29%)
Similarity:116/246 - (47%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISLR------RRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQA 86
            ||||.....|::|.|:|||      ....|.||||||...:::|||||: |..:..|| ...:|.
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCI-QSQDADPA-VYRVQV 93

  Fly    87 GSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVD- 148
            |.:.|......:.::.:.:||:||  |...|:|:::|...|..::|::.:.|    |.:.:|.| 
Mouse    94 GEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSL----PKDSSTFDS 154

  Fly   149 -----ISGWGAISQRGPIS--NSLLYVQVKALSRESCQKTYLRQLPE--------TTMCLLHPKD 198
                 :.|||.:.||.|:.  ..|..|::.....:||::.|.::..:        ..|.......
Mouse   155 TDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSG 219

  Fly   199 KGACYGDSGGP----ATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWI 245
            :|.|:||||||    .:.:...||:.|..| .|....|..:.||.....||
Mouse   220 RGPCFGDSGGPLVCWKSNKWIQVGVVSKGI-DCSNNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/244 (29%)
Tryp_SPc 28..248 CDD:238113 72/246 (29%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 72/246 (29%)
Tryp_SPc 31..269 CDD:214473 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.