DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and CLIPB36

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003436427.1 Gene:CLIPB36 / 11175953 VectorBaseID:AGAP013184 Length:394 Species:Anopheles gambiae


Alignment Length:248 Identity:60/248 - (24%)
Similarity:105/248 - (42%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GQFPHQISLRRRG-SHT----CGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG--------- 87
            |..|..:.|...| :|:    |.|::|:..||:|:|.||   ::.|..|.|.::.|         
Mosquito   145 GHHPWTVLLHYGGQAHSTQFNCSGTLIAPSYVLTSASCV---DDEAAWNNLTVRLGEWDLESTVD 206

  Fly    88 --------SLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPND 144
                    .|:.:.....|||..|.:|..|....:|:|:|:|......|..::.|.|......|:
Mosquito   207 CILDPDSDDLVCADPSYDVPVGQVILHEAYTGRRNDIALLKLAQPAQLNDWVSPICLPESPVLNE 271

  Fly   145 -ATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETT---MCLLHPKDKGACYGD 205
             |....:||...:...|.|.........||::::|:: |:..:..|:   :|:...:::.  .||
Mosquito   272 TAKYGAAGWNQNTCADPSSRYKQLSSYDALNQKACER-YVPSVAGTSYGFVCVAVGEEQP--LGD 333

  Fly   206 SGGPAT------YQGK----LVGLASFVIGGCGRAAPDGYERVSKLRNWIAEK 248
            :||..|      ..|:    |||:.|.:...........|.||::..:||..|
Mosquito   334 AGGGLTAVRTIDSAGRSVHELVGVLSSLSSCANFQGVSVYTRVAQYVDWIESK 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 57/243 (23%)
Tryp_SPc 28..248 CDD:238113 59/246 (24%)
CLIPB36XP_003436427.1 CLIP 37..90 CDD:288855
Tryp_SPc 143..386 CDD:238113 59/246 (24%)
Tryp_SPc 143..383 CDD:214473 57/243 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.