DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP013221

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003436543.1 Gene:AgaP_AGAP013221 / 11175927 VectorBaseID:AGAP013221 Length:318 Species:Anopheles gambiae


Alignment Length:264 Identity:80/264 - (30%)
Similarity:116/264 - (43%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NDSVVEPRIVGGTKAREGQFPHQISL---RRRG-----SHTCGGSIISKDYVVTAAHCVKQGNNV 76
            |.|.|...||||..|:.|:||||..|   |..|     |.:||||:||..:::|||||...|:.|
Mosquito    64 NCSNVVDLIVGGEAAKHGEFPHQALLGYPREDGSPEPYSFSCGGSLISDRFILTAAHCFSYGDPV 128

  Fly    77 -APANELEIQAGSLLLSSGGVRVPVATVTVHPNY-NSNG-HDVAVLRLRNSLTFNSNIAAIKLAT 138
             ....|.::...|......|    :|.:..||.| ||.. ||:|::||..::.|:..|....|.|
Mosquito   129 IVRLGEYDLTVDSTTQLDFG----IAEIIRHPKYRNSRSYHDLALVRLNETVLFSKVIRPACLWT 189

  Fly   139 EDPPNDATVDISGWGAISQRG--PISNSLLYVQVKALSRESC------QKTYLRQLPETTMC--- 192
            ....|.:....:|:|. .:.|  .:|..|:.||:.......|      .:.:...:.|..:|   
Mosquito   190 NPTLNVSRFVATGFGK-QEEGSTDLSTKLMKVQLDLFPSSDCGELFRDNRKFRDGIDEGQLCVGS 253

  Fly   193 LLHPKDKGACYGDSGGP---------ATYQGKLVGLASFVIGGCGRAAPDG-----YERVSKLRN 243
            |:..||  .|.||||||         ..|  .:||:.|     .|.|...|     |.:|:...:
Mosquito   254 LIGGKD--TCQGDSGGPLQTITEPRSCIY--NIVGVTS-----TGAACGVGNSKAIYSKVAHYLD 309

  Fly   244 WIAE 247
            ||.:
Mosquito   310 WIEQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/253 (30%)
Tryp_SPc 28..248 CDD:238113 77/256 (30%)
AgaP_AGAP013221XP_003436543.1 Tryp_SPc 72..314 CDD:238113 77/256 (30%)
Tryp_SPc 72..311 CDD:214473 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.