DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP013089

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003436251.1 Gene:AgaP_AGAP013089 / 11175918 VectorBaseID:AGAP013089 Length:634 Species:Anopheles gambiae


Alignment Length:259 Identity:75/259 - (28%)
Similarity:111/259 - (42%) Gaps:50/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGS---------HTCGGSIISKDYVVTAAHCVKQGNNVAPANEL 82
            |:|||..|:...:|...:|..|.:         ..|||::|:..:|:|.|||::.........||
Mosquito   380 RVVGGVDAQLNAWPWMAALGYRSTSFELNAGPRFLCGGTLITTLHVLTVAHCIQTALYFVRLGEL 444

  Fly    83 EI---QAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNSNIAAIKLATEDPP 142
            :|   |.|     :..|.:.:....||..|:...  :|:|::.|:.|:|....:..|.|..|  .
Mosquito   445 DITSDQDG-----ANPVDIYIQRWVVHERYDEKKIYNDIALVLLQKSVTITEAVRPICLPVE--A 502

  Fly   143 NDATVD-------ISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLP-----ETTMCLLH 195
            ...|.|       |:||||:...||.:..|...||..|..:.|...|....|     :|.:|...
Mosquito   503 KQRTKDLTYYAPFIAGWGAVGYNGPTAARLQEAQVVVLPVDQCAFNYKLYFPGQIFDDTVLCAGF 567

  Fly   196 PK-DKGACYGDSGGPAT----------YQGKLVGLASFVIGG--CGRAA-PDGYERVSKLRNWI 245
            |: .|.:|.||||||..          |...|:||.|:   |  |.||. |..|.:|:....||
Mosquito   568 PQGGKDSCQGDSGGPLMLPELSSNGQYYYYTLIGLISY---GYECARAGFPGVYVKVTAYLPWI 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/257 (28%)
Tryp_SPc 28..248 CDD:238113 74/258 (29%)
AgaP_AGAP013089XP_003436251.1 CLIP 250..304 CDD:288855
Tryp_SPc 380..628 CDD:214473 73/257 (28%)
Tryp_SPc 381..631 CDD:238113 74/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.