DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and AgaP_AGAP012946

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003436544.1 Gene:AgaP_AGAP012946 / 11175517 VectorBaseID:AGAP012946 Length:318 Species:Anopheles gambiae


Alignment Length:254 Identity:66/254 - (25%)
Similarity:119/254 - (46%) Gaps:46/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISL---RRRGSH-----TCGGSIISKDYVVTAAHCVKQGNNVAPANELEI 84
            ||||.:|:.|:|||...|   :..|:.     .|||::||..:::|||||...|:.|.      :
Mosquito    69 IVGGEQAKYGEFPHHALLGFSKENGNQWDYDFRCGGTLISDQHILTAAHCFAYGDPVI------V 127

  Fly    85 QAGSL---LLSSGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLTFNSNIAAIKLATEDPPND 144
            :.|..   |.:.......:|::..||||::  :..|:|:::|::.:..:.:|....|...:..|.
Mosquito   128 RVGEYDTELETDDEYDSDIASIRRHPNYSNLRSYDDIALVKLKHPIVLSKHIRPACLWETEERNS 192

  Fly   145 ATVDISGWGAISQRG-PISNSLLYVQVKALSRESCQKTY-----LRQ-LPETTMC---LLHPKDK 199
            .....:|:|.....| .:|..::.|.:.......|::.:     .:| :.:..:|   ::..:| 
Mosquito   193 TRYIATGFGYNETYGTTLSTVMMKVNLDEFPVSDCERNFKGDRRFKQGVRDGQLCVGSIVEGRD- 256

  Fly   200 GACYGDSGGP---------ATYQGKLVGLASFVIGG-CGRA-APDGYERVSKLRNWIAE 247
             .|.||||||         .:|  .:||:.|  :|| ||.. |...|.:||...:||.:
Mosquito   257 -TCQGDSGGPLQVVTNTKSCSY--GVVGITS--VGGVCGIGNAKAIYTKVSHYIDWIED 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 64/250 (26%)
Tryp_SPc 28..248 CDD:238113 66/254 (26%)
AgaP_AGAP012946XP_003436544.1 Tryp_SPc 69..311 CDD:238113 66/254 (26%)
Tryp_SPc 69..308 CDD:214473 64/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.