DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC108647852

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:276 Identity:75/276 - (27%)
Similarity:126/276 - (45%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR---RRG-SHTCGGSIISKDYVVTAA 67
            |:|..|....|.:|...|. |::.|.....|.:|...|::   :.| ...|||.::|..:|||||
 Frog    24 SILKTCGIRPLVKNHHRVR-RVIEGNTPEPGSWPWMASIQLLYKDGYGSACGGVLLSNRWVVTAA 87

  Fly    68 HC---VKQGNNVAPANELEIQAGSLLLSSGGVRVPVATV---TVHPNYNSNGH--DVAVLRLRNS 124
            ||   :|:..::|     .|..|:..|:..|....:.|:   ..|.:::...|  |:|::||...
 Frog    88 HCLSDLKRYRHLA-----RIVLGARDLTQLGPETQIRTIKQWIQHEDFDHKTHKNDIALIRLNYP 147

  Fly   125 LTFNSNIAAIKLATEDPPNDATV------DISGWGAISQR-GPISNSLLYVQVKALSRESCQKT- 181
            :.|:..|....|    ||..:.|      .|:|||.:::: ..::..|....|:.:.|:.|..: 
 Frog   148 VKFSDYIQPACL----PPKSSNVYKMDDCHIAGWGLLNEKPRTVTTMLQEATVELIDRKRCNSSD 208

  Fly   182 -YLRQLPETTMCLLHPKDKG---ACYGDSGGPATYQGK------LVGLASFVIGG-CGRAAPDG- 234
             |...:.:..:|..:  ::|   .|.||||||...:.|      :||:.|:  || ||:...:| 
 Frog   209 WYNGGIHDDNLCAGY--EQGGPDVCMGDSGGPLMCKRKKAGIYYVVGIVSW--GGLCGQPHSNGV 269

  Fly   235 YERVSKLRNWIAEKAS 250
            |..|.....||..|.|
 Frog   270 YTSVQDFEQWIFNKTS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 65/249 (26%)
Tryp_SPc 28..248 CDD:238113 66/251 (26%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.