DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:250 Identity:73/250 - (29%)
Similarity:115/250 - (46%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNN---- 75
            |::..|.|   ...|||..:....:|.|.||......|||||:|:|::|::||||.....|    
Zfish   298 GIIPVNSS---NGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYL 359

  Fly    76 ---VAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLRLRNSLTFNSNIAAIK 135
               :.|..:.:.....:..|       |..|..||.|  |:|.:|:|::||...:||..:|..:.
Zfish   360 TVILGPKTQNKYDPSRISRS-------VKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVC 417

  Fly   136 LATEDP--PNDATVDISGWGAISQRGPISNSLLY--VQVKALSRESCQKTY-LRQLPETTMCL-L 194
            ||.|..  .:|....|:.|..||...|:.:..::  |:|..:....|...| :..:.:..:|. |
Zfish   418 LAAEGSVFNSDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAGL 482

  Fly   195 HPKDKGACYGDSGGPATYQGKLVGLASFVI---GGCGRAA-PDGYERVSKLRNWI 245
            ..:.|..|.||||||.......|.:.|.::   .||.::. |..|.|||:.:.||
Zfish   483 LKEGKDLCQGDSGGPMVSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 68/236 (29%)
Tryp_SPc 28..248 CDD:238113 69/236 (29%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 68/234 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.