DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Try5

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:254 Identity:75/254 - (29%)
Similarity:115/254 - (45%) Gaps:28/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK 71
            :||.|...|.........:.:||||...:|...|:|:|| ..|.|.||||:|:..:||:||||.|
  Rat     3 ALLFLAHVGAAVAFPIDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYK 66

  Fly    72 ---------QGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSL 125
                     ...||...||..:.|              |.:..|||:|:.  .:|:.:::|...:
  Rat    67 SRIQVRLGEHNINVLEGNEQFVNA--------------AKIIKHPNFNARNLNNDIMLIKLSVPV 117

  Fly   126 TFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPET 189
            |.||.:|.:.|.:...|......|||||.....|..:..||. :....|.:..|:.:|..::...
  Rat   118 TLNSRVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNN 182

  Fly   190 TMCL-LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247
            .:|: .....|.:|.||||||....|:|.|:.|:..|...:..|..|.:|....:||.:
  Rat   183 MICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/230 (30%)
Tryp_SPc 28..248 CDD:238113 71/233 (30%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 69/230 (30%)
Tryp_SPc 24..242 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.