DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:261 Identity:91/261 - (34%)
Similarity:127/261 - (48%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSV-------VEPRIVGGTKAREGQFPHQISLRR---RGSHTCGGSIISKDYVVTA 66
            ||:|.:.....:       |:.||||||.|..|.:|.|:.|.:   ...:.||||||:..::|||
 Frog   242 CASGNMVSLRCISCGLSTKVDSRIVGGTPASVGDWPWQVELLKLVGTSIYLCGGSIITPHWIVTA 306

  Fly    67 AHCVKQGNNVAPANELEIQAGSLLLS---SGGVRVPVATVTVHPNYNS--NGHDVAVLRLRNSLT 126
            |||| .|:...| :..::.||||.:.   |.|..|..|  .|||:|:|  ..:|||:|:|..:|.
 Frog   307 AHCV-YGSTSTP-SAFKVFAGSLTIQSYYSAGYTVERA--LVHPSYSSYTQIYDVALLKLTAALV 367

  Fly   127 FNSNIAAIKLATEDPP--NDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQK--TYLRQLP 187
            |.:|:..:.|.....|  ......|||||..::.|.||.:|:...|..:|..:|.:  .|...:.
 Frog   368 FTTNLRPVCLPNVGMPWAEGQPCWISGWGTTAEGGSISKNLMAASVPIISSTTCNQAAVYGGAIS 432

  Fly   188 ETTMC---LLHPKDKGACYGDSGGPATYQGK----LVGLASFVIGGCGRA-APDGYERVSKLRNW 244
            .|.||   |....|  .|.||||||...:..    |||..|:.. ||.|| .|..|..|:....|
 Frog   433 STMMCAGYLSGGTD--TCQGDSGGPLVTKTNSLWWLVGDTSWGY-GCARAYKPGVYGNVTVFIEW 494

  Fly   245 I 245
            |
 Frog   495 I 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 85/237 (36%)
Tryp_SPc 28..248 CDD:238113 86/238 (36%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 3/16 (19%)
Tryp_SPc 265..498 CDD:238113 86/238 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.