DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC101730792

DIOPT Version :10

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 XenbaseID:XB-GENE-29084831 Length:146 Species:Xenopus tropicalis


Alignment Length:45 Identity:8/45 - (17%)
Similarity:22/45 - (48%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SCYY---NYYLTQEQIVHFVIGAMTVILCARLFIMYLTAKSEVTK 207
            |.|:   ::|::.:.:.|...|.:.|:...:  ::.|..:..:.|
 Frog   202 SIYFQPPSFYVSAQDLPHIENGGVAVLTGKK--VVQLDVRDNMVK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 28..248 CDD:238113 8/45 (18%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.