DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Klk9

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:249 Identity:68/249 - (27%)
Similarity:98/249 - (39%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG-- 87
            :.|.||..:......|.|..|.......||.::|:..:::|||||.|.        .|.::.|  
Mouse    20 DTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHCRKP--------YLWVRLGEH 76

  Fly    88 ---------SLLLSSGGVRVPVATVTVHPNYN----SNGH--DVAVLRLRNSLTFNSNIAAIKLA 137
                     .|||        |.....||.:|    :|.|  |:.::||...:.....:..:.|.
Mouse    77 HLWRWEGPEQLLL--------VTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLTPAVQPLNLT 133

  Fly   138 TEDPPNDATVDISGWGAISQRGPISNSLLY------VQVKALSRESCQKTYLRQLPETTMCL-LH 195
            ...||......|||||::|     |:.|.|      ..:..|..:.|:..|...:.|..:|. |.
Mouse   134 ESRPPVGTQCLISGWGSVS-----SSKLQYPMTLQCANISILDNKLCRWAYPGHISEKMLCAGLW 193

  Fly   196 PKDKGACYGDSGGPATYQGKLVGLASFVIGG---CGR-AAPDGYERVSKLRNWI 245
            ...:|:|.||||||...:|.|.|:.|   ||   |.| ..|..|..|.....||
Mouse   194 EGGRGSCQGDSGGPLVCEGTLAGIVS---GGSEPCSRPRRPAVYTNVFDYLEWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/245 (27%)
Tryp_SPc 28..248 CDD:238113 67/246 (27%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.