DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and cela1.2

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:268 Identity:85/268 - (31%)
Similarity:125/268 - (46%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQ----NDSVVEPRIVGGTKAREGQFPHQISLRRRGSHT----CGGSIISKDYVV 64
            ||.:.|...||:    .|..:|.|:|||..|:...:|.||||:.....|    |.|::|...:|:
Zfish     6 LLSVLATLALAEPRYLKDIAIEERVVGGEIAKPHSWPWQISLQYSDLGTYYYYCSGTLIRPGWVM 70

  Fly    65 TAAHCVKQGNNVAPANELEIQAGSLLLSSGGV--------RVPVATVTVHPNYNSN----GHDVA 117
            .|||||:           .::..::.|....:        .:.|:.|.:|||:|.|    |:|:|
Zfish    71 VAAHCVE-----------ALRKWTVALGDHDIYTHEGPEQYISVSEVFIHPNWNPNNVAFGYDIA 124

  Fly   118 VLRLRNSLTFNS--NIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESC-Q 179
            :|||....|.:|  .:|.:..:.|..|...|..|:|||.....|.:|..|....:..:..|:| |
Zfish   125 LLRLSIDATLSSYVQVATLPSSGEILPYGHTCYITGWGYTETGGSLSAQLKQAYMPVVDYETCSQ 189

  Fly   180 KTYL-RQLPETTMCLLHPKDKGACYGDSGGP--ATYQGKLV--GLASFVI-GGCGR-AAPDGYER 237
            |.:. ..:.||.:|........||:||||.|  ..:.||.|  |:.|||. .||.. ..|.|:.|
Zfish   190 KDWWGSSVKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVHGVTSFVSPEGCNTYKKPTGFTR 254

  Fly   238 VSKLRNWI 245
            ||...|||
Zfish   255 VSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 76/243 (31%)
Tryp_SPc 28..248 CDD:238113 77/244 (32%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 76/243 (31%)
Tryp_SPc 30..265 CDD:238113 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.