DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC100497505

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002940490.1 Gene:LOC100497505 / 100497505 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:272 Identity:71/272 - (26%)
Similarity:114/272 - (41%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISL--RRRGS----HTCGGSIISKDYVVTAAHCV 70
            |......||.:   .|||.|.:.|...:|.|:||  |.||.    |.|||::|.|.:::|||||.
 Frog    38 CGVSFFQQNTA---GRIVSGNEVRPYSWPWQVSLQVRPRGGKKYVHVCGGTLIHKSWILTAAHCF 99

  Fly    71 KQGNNVAPANELEIQAGSLLLSSGGVRVPVATVT--------VHPNYNSNGHDVAVLRLRNSL-- 125
            ::|.....|| ..|..|...|:.......|.:|.        .:|..|...:|:|:::....:  
 Frog   100 QKGKAEDAAN-WRIVVGKHNLNRTEATEKVYSVKRIYRHERFSYPQLNDLDYDIALVKPAEDIIT 163

  Fly   126 TFNSNIAAIKLATEDPPNDATVD------ISGWGAISQRG-----PISNSLLYVQVKALSRESC- 178
            |...:.|.:      |..:..:.      ::|||  ..||     .:|..|...::..:..::| 
 Frog   164 THFIHYACL------PKKEMAMHPGHFCWVTGWG--DTRGGQGNVTLSEVLNQARLPIIDTKTCR 220

  Fly   179 -QKTYLRQLPETTMCLLHPKDKG---ACYGDSGGPATYQG-----KLVGLASFVIGGCG-RAAPD 233
             :|.:..::.|:.:|.......|   ||.||||||...|.     ::.|:.||...||. ...|.
 Frog   221 HKKFWGDRIRESMICAGFRNVGGPPAACQGDSGGPLVCQDGRGRWEVHGIVSFGPVGCTVENKPS 285

  Fly   234 GYERVSKLRNWI 245
            .:.:.|....||
 Frog   286 VFTKTSTYIPWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/255 (26%)
Tryp_SPc 28..248 CDD:238113 67/256 (26%)
LOC100497505XP_002940490.1 Tryp_SPc 51..300 CDD:238113 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.