DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and f12

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:251 Identity:69/251 - (27%)
Similarity:109/251 - (43%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELE 83
            |....:.||||||..|.....|: |:.....:|.||||:||..::||||||:.|..||...:.:.
 Frog   350 QKTPSIMPRIVGGLVALPASHPY-IAALYIDNHFCGGSLISPCWIVTAAHCLDQRPNVTKISVVL 413

  Fly    84 IQAGSLLLSSGGVRVPVATVTVHPNY--NSNGHDVAVLRLR--NSL---TFNSNIAAIKLATEDP 141
            .|:.........|.:.|....:|..|  ::..||:|:::::  |.|   .|:..:..|.|..:..
 Frog   414 GQSRFNTTDQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICLPQQFK 478

  Fly   142 PNDATVD--ISGWGAISQRGPISNSLLYVQ---VKALSRESCQKTYL---RQLPETTMCLLHPKD 198
            ..::|..  ::|||  .|.....:...::|   :..:....||...:   |.||...........
 Frog   479 MAESTKQCVVAGWG--HQYEGAEHYAFFLQEASMPIIPYTQCQSPSVHGDRMLPGMLCAGFMEGG 541

  Fly   199 KGACYGDSGGPATYQ--GK--LVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKAS 250
            ..||.||||||...:  |:  |.|:.|:..|......|..|..|:...:||....|
 Frog   542 VDACQGDSGGPLVCEVDGRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWIRANIS 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 64/236 (27%)
Tryp_SPc 28..248 CDD:238113 65/238 (27%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 65/238 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.