DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC100485189

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:230 Identity:64/230 - (27%)
Similarity:109/230 - (47%) Gaps:17/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAG--SL 89
            ||:|||:.|....|...||.....|.|||.:|.:::|:|||||        ..:.|:::.|  :|
 Frog    21 RIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHC--------QLSSLQVRLGEHNL 77

  Fly    90 LLSSGGVRVPVA-TVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISG 151
            .:..|..:...| .:..|..:|  :..:|:.:|:|.:.:|.|..:..|.|......:..|..:||
 Frog    78 AVYEGKEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDYVQTIPLGCPTVGDGETCLVSG 142

  Fly   152 WG-AISQRGPISNSLLYVQVKALSRESCQKTY-LRQLPETTMCL-LHPKDKGACYGDSGGPATYQ 213
            || ..|......:.|..|:|:.:|::.||..: ..::.:..:|. :....|.:|.||||||....
 Frog   143 WGTTTSPEETFPDELQCVEVQTVSQDYCQGAFPTDEITDNMLCAGVMEGGKDSCQGDSGGPLVCN 207

  Fly   214 GKLVGLASFVIGGCGRAAPDG-YERVSKLRNWIAE 247
            ..:.|:.|:....||.|...| |.::.....||.:
 Frog   208 SMVHGITSWGNTPCGVANKPGIYTKICNYIAWIQD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 62/226 (27%)
Tryp_SPc 28..248 CDD:238113 63/229 (28%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 63/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.