DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and gzma

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:241 Identity:72/241 - (29%)
Similarity:111/241 - (46%) Gaps:35/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISL-RRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLL 91
            |:.|.:|.....|:...: .|.||  |||::|.:::|:||||||        .|..|:..|:..:
 Frog    35 IIDGREAASHSRPYMAYIYSRTGS--CGGTLIKQNWVLTAAHCV--------VNNSEVILGAHKV 89

  Fly    92 SS---GGVRVPVATVTVHP--NYNSNGHDVAVLRLRNSLTFNSNIAAIKLATED---PPNDATVD 148
            .|   ...|..||....||  .:....||:.:|:::.:...|..::.:||.|.|   .|. ::..
 Frog    90 KSRENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDMDVKPG-SSCS 153

  Fly   149 ISGWGAISQRGPI-SNSLLYVQVKALSRESCQKTYLR---QLPETTMCLLHPK--DK--GACYGD 205
            .:|||.....|.. |:.|..|.|..:.|.:|.|.|.:   ::....:|...||  ||  .||.||
 Frog   154 TAGWGVTKPNGKTPSDVLREVNVTVVDRGTCNKIYKKFKTEISTNMLCAGAPKKSDKKYDACQGD 218

  Fly   206 SGGPATYQGKLVGLASFVIGG--CGRAA-PDGYERV-SKLRNWIAE 247
            ||||.....:..|:.||   |  ||... |..|.|: ::...||.:
 Frog   219 SGGPLICGKEFSGIVSF---GKKCGDPKYPGIYTRLTARYLQWIRD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/237 (30%)
Tryp_SPc 28..248 CDD:238113 72/241 (30%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.