DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and tmprss12

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:294 Identity:85/294 - (28%)
Similarity:134/294 - (45%) Gaps:56/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPFWTSLLVLCAAGVLAQNDSVV--EP--------RIVGGTKAREGQFPHQISLR-----RRGS 50
            |.|.....|.||..|::...||.|  ||        |||||..|..|.:|.|:||:     ...|
 Frog     4 MGPMLHLTLSLCWLGIIQAIDSEVCGEPPLVHTPGSRIVGGRNALPGAWPWQVSLQYFRTLSGYS 68

  Fly    51 HTCGGSIISKDYVVTAAHCVKQGNN------VAPANELEIQAGSLLLSSGGVRVPVATVTVHPNY 109
            |.||||:|..::|::||||.:...|      |...:.:.::...:      |:..:..:.:|.:|
 Frog    69 HRCGGSLIQNNWVLSAAHCFRANRNPEYWRAVLGLHNIFMEGSPV------VKAKIKQIIIHASY 127

  Fly   110 N--SNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATV-DISGWGAISQRGPISNSLLYVQVK 171
            :  :..:|:|:|.|.:.:|::..|..:.|.:...|:..|. .|:|||...::|.||..|....|:
 Frog   128 DHIAITNDIALLLLHDFVTYSDYIHPVCLGSVTVPDSLTACFITGWGVTKEKGSISVILQEALVQ 192

  Fly   172 ALSRESC--QKTYLRQLPETTMCLLHPKDKGA---CYGDSGGPAT---------YQGKLVGLASF 222
            .:....|  ..:|...:.::.:|.  ..:.||   |.||||||..         ||   :|:.||
 Frog   193 TIPYSECNSSSSYNGFITQSMICA--GDNSGAVDSCQGDSGGPFVCYNTERMRFYQ---MGITSF 252

  Fly   223 VIGGCGRA-APDGYERVSKLRNWIA-----EKAS 250
            .. |||:. .|..|.:|....:||.     ||.|
 Frog   253 GY-GCGKPNFPGVYTKVESYVSWIKAHMAYEKTS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/246 (28%)
Tryp_SPc 28..248 CDD:238113 70/253 (28%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.