DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and zgc:165423

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:271 Identity:88/271 - (32%)
Similarity:124/271 - (45%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FWTSLLVLCAAGVL-------------AQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGG 55
            || .|.:||...:|             |...:.:..:|||||.|..|.:|.|.||...|||.|||
Zfish     2 FW-KLSLLCVVTLLSTGCDCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGG 65

  Fly    56 SIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGH--DVAV 118
            |:||..::::||||.....|.:.......:....|.:...|...|:.|.|||.|..:.|  |:|:
Zfish    66 SLISDQWILSAAHCFPSNPNPSDYTVYLGRQSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMAL 130

  Fly   119 LRLRNSLTFNSNIAAIKLATEDPP--NDATVDISGWGAISQRG---PISNSLLYVQVKALSRESC 178
            |.|.:.:||::.|..:.||.:...  || |:.|:|||.| :.|   |....|..|.|..:....|
Zfish   131 LHLSSPVTFSNYIQPVCLAADGSTFYND-TMWITGWGTI-ESGVSLPSPQILQEVNVPIVGNNLC 193

  Fly   179 QKTY--LRQLPETTMCL-LHPKDKGACYGDSGGPATYQG----KLVGLASFVIGGCGRAAPDGYE 236
            ...|  ...:....||. |....|.:|.||||||...:.    ...|:.||..|......|..|.
Zfish   194 NCLYGGGSSITNNMMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYA 258

  Fly   237 RVSKLRNWIAE 247
            |||:.:|||::
Zfish   259 RVSQYQNWISQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/231 (34%)
Tryp_SPc 28..248 CDD:238113 81/234 (35%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 79/231 (34%)
Tryp_SPc 38..269 CDD:238113 81/232 (35%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.