DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and Gm10334

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:258 Identity:80/258 - (31%)
Similarity:118/258 - (45%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVK- 71
            :|.|..|.|....|.  :.:||||...:|...|:|:|| ..|.|.||||:|:..:||:||||.| 
Mouse     6 ILALVGAAVAFPVDD--DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYKT 67

  Fly    72 --------QGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLT 126
                    ...||...||..:.|              |.:..|||:|..  .:|:.:::|.:.:|
Mouse    68 RIQVRLGEHNINVLEGNEQFVNA--------------AKIIKHPNFNRKTLNNDIMLIKLSSPVT 118

  Fly   127 FNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTYLRQLPETT 190
            .|:.:|.:.|.:...|......|||||.....|.....||. :....|.:..|:.:|..::....
Mouse   119 LNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITGNM 183

  Fly   191 MC---LLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDG---YERVSKLRNWIAE 247
            :|   |...||  :|.||||||....|:|.|:.|:   |.|.|.||.   |.:|....:||.:
Mouse   184 VCAGFLEGGKD--SCQGDSGGPVVCNGELQGIVSW---GYGCALPDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 73/235 (31%)
Tryp_SPc 28..248 CDD:238113 75/238 (32%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.