DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and si:dkey-21e2.14

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003201094.1 Gene:si:dkey-21e2.14 / 100034620 ZFINID:ZDB-GENE-050208-699 Length:251 Species:Danio rerio


Alignment Length:229 Identity:69/229 - (30%)
Similarity:117/229 - (51%) Gaps:15/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLS 92
            ||.|.:|:....|:.:|::....|.||||:|::::|:|||||.|:      ::.|.:..|:..||
Zfish    26 IVDGREAKPHSRPYMVSVQYYEQHICGGSLITEEFVLTAAHCWKE------SDILTVVVGAHDLS 84

  Fly    93 SGGV--RVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLAT--EDPPNDATVDISG 151
            ...:  ...||:...||:||||  |:|:.:|:|:..:..:.|:..|.|..  ||...|....::|
Zfish    85 KDKMYNSFEVASYLPHPDYNSNTLGNDLMLLKLKEKVRLSDNVGLISLPKDGEDVEADTHCSVAG 149

  Fly   152 WGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDKGACYGDSGGPATYQGKL 216
            ||.:...||:|:.|:..:...:....|::.:......:.:..::... |:|.||||||.......
Zfish   150 WGTLWMNGPVSDRLMEAETVIMYDAECERRWGSDYMASKLICVYGYG-GSCIGDSGGPLVCGVTA 213

  Fly   217 VGLASFVIGG-C-GRAAPDGYERVSKLRNWIAEK 248
            ||:.|:.... | .|..|:.|.|:|....||..|
Zfish   214 VGVTSYSDHYLCNSRLLPNVYTRISAYLKWIHHK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/224 (29%)
Tryp_SPc 28..248 CDD:238113 68/227 (30%)
si:dkey-21e2.14XP_003201094.1 Tryp_SPc 26..245 CDD:238113 67/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.