DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and si:dkey-78l4.6

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003201079.2 Gene:si:dkey-78l4.6 / 100034588 ZFINID:ZDB-GENE-060503-83 Length:251 Species:Danio rerio


Alignment Length:232 Identity:65/232 - (28%)
Similarity:107/232 - (46%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLS 92
            ||.|.:|:....|:.:|::..|.:.|||.:||..:|:|||.|..|..::.    :.:.|..|...
Zfish    26 IVDGQEAKPHSRPYMVSVQLFGQNICGGFLISDQFVLTAAQCWHQNQDLT----VVVGAHDLRKR 86

  Fly    93 SGGVRVPVATVTVHPNYNSN--GHDVAVLRLRNSLTFNSNIAAIKLATEDPPN------DATVDI 149
            .......|.:...|||:||.  .:|:.:|:|:..:..|:.|..|.|    |.|      |....:
Zfish    87 QNSKNFIVKSHITHPNFNSKTFENDIMLLKLKGKVPLNNKIRPISL----PKNGESFKADTPCSV 147

  Fly   150 SGWGAISQRGPISNSLLYVQVKALSRESCQKTY-LRQLPETTMCLL-HPKDKGACYGDSGGPATY 212
            :|||.:..:||:|:.||..:...::...|:..: ...:|...:|.. |   .|:|.||.|||...
Zfish   148 AGWGRLWTKGPVSDLLLEAKTAIVNDAECKLRWGSHYVPSMMICAFGH---GGSCNGDGGGPLVC 209

  Fly   213 QGKLVGLASF---VIGGC-GRAAPDGYERVSKLRNWI 245
            ....||:..|   .:  | .|..|:.|.::|....||
Zfish   210 NNTAVGVTIFRDRYL--CNSRLLPNVYTKISAYLPWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/230 (27%)
Tryp_SPc 28..248 CDD:238113 65/232 (28%)
si:dkey-78l4.6XP_003201079.2 Tryp_SPc 26..247 CDD:238113 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.