DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and zgc:163079

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:262 Identity:71/262 - (27%)
Similarity:123/262 - (46%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQND----SVVEPRIVGGTKAREGQFPHQISLRRRGSHT--CGGSIISKDYVVTAA 67
            ::|..||.|.|:|    :.:..:|:||..|.:|.:|.|.|:..:.:..  ||||:|:|.:|:|.|
Zfish    13 ILLNIAGCLGQSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTA 77

  Fly    68 HCVKQGNNVAPANELEIQAGSLLLSSGG---VRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNS 129
            ....    :.||:::.:..|....:...   :...|..:..||||||...::|:|:|.:.:||:.
Zfish    78 KVFA----LMPASDIVVYLGRQTQNGSNPYEISRTVTKIIKHPNYNSLDSNLALLKLSSPVTFSD 138

  Fly   130 NIAAIKLATEDPPNDATVD-----ISGWGAISQRGPISNSLL-----YVQVKALSRESCQKTYLR 184
            .|..:.||.   .....||     ::|||.:::...:...:|     .|:...::...|...|..
Zfish   139 YIKPVCLAA---AGSVFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGG 200

  Fly   185 QLPETTMC--LLHPKDKGACYGDSGGPATYQGKLVGLASFVI--GGCGRAA-PDGYERVSKLRNW 244
            .:....:|  .|:...|..|.||.|||...:...:.:.|.|:  |.||... |..|.|||:..:|
Zfish   201 IITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGYCGLPGYPTIYVRVSEYEDW 265

  Fly   245 IA 246
            |:
Zfish   266 IS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/237 (27%)
Tryp_SPc 28..248 CDD:238113 65/239 (27%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 63/237 (27%)
Tryp_SPc 36..267 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.