DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9676 and LOC100004427

DIOPT Version :9

Sequence 1:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:266 Identity:78/266 - (29%)
Similarity:121/266 - (45%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLCAAGVLAQND----SVVEPRIVGGTKAREGQFPHQ--ISLRRRGSHTCGGSIISKDYVVTAA 67
            ::|..||.|.|:|    :.:..:||||..|.||.:|.|  |:.:..|...|.||:||:.:|:|||
Zfish    13 VLLNIAGCLGQSDVCGRAPLNTKIVGGLNATEGSWPWQASINFKSTGQFFCSGSLISERWVLTAA 77

  Fly    68 HCVKQGNNVAPANELEIQAGSLLLS-SGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNI 131
            .|.::.|    .:::.|..|.|..: |....:|...:.|     |...|:|:::|.:|:||...|
Zfish    78 SCFQRIN----VSDVVIYLGRLTTNGSNPYEIPRTVIQV-----SVTEDIALVQLSSSVTFTDYI 133

  Fly   132 AAIKLATEDPPNDATVD-----ISGWGAISQRGPI-SNSLLYVQVKALSRESCQK----TYLRQL 186
            ..:.||.   .....||     ::|||:.|....| |:.|..|:...::...|..    |.|   
Zfish   134 RPVCLAA---AGSVFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNL--- 192

  Fly   187 PETTMC--LLHPKDKGACYGDSGGP-ATYQGK---LVGLASFVIGGCGR-AAPDGYERVSKLRNW 244
             :..:|  .::...|..|:.|.|.| .|.||.   ..|:..|..  ||: ..|..|.|||:...|
Zfish   193 -DNVICAGFVNETGKAPCWEDFGSPLVTRQGSQWIQSGVVVFTF--CGQNGFPTLYARVSEYEEW 254

  Fly   245 IAEKAS 250
            |....|
Zfish   255 IRNYTS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 69/237 (29%)
Tryp_SPc 28..248 CDD:238113 71/239 (30%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 69/237 (29%)
Tryp_SPc 36..257 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.