DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep4 and TOC120

DIOPT Version :9

Sequence 1:NP_573147.2 Gene:Sep4 / 32646 FlyBaseID:FBgn0259923 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_188284.1 Gene:TOC120 / 820913 AraportID:AT3G16620 Length:1089 Species:Arabidopsis thaliana


Alignment Length:135 Identity:37/135 - (27%)
Similarity:59/135 - (43%) Gaps:45/135 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GVASVISTMNGSSSSGIEAVKCRPPIYPKPKTPSFDKDRDYIGFATLPEQVHRKSV-KRGFEFTL 88
            |:|..:...|||                  :..:|..||    .:.:.||:...:. ...|..|:
plant   417 GLAEQLRGRNGS------------------RVGAFSFDR----ASAMAEQLEAAAQDPLDFSCTI 459

  Fly    89 MVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKV----EKKTMDIE--ERGVRLRLTV 147
            ||:|:||:|||..|||:|              :.::.:|..    .||..|||  .:|:::|  |
plant   460 MVLGKSGVGKSATINSIF--------------DELKISTDAFQVGTKKVQDIEGFVQGIKVR--V 508

  Fly   148 VDTPG 152
            :||||
plant   509 IDTPG 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep4NP_573147.2 CDC3 65..420 CDD:227352 29/95 (31%)
CDC_Septin 82..357 CDD:206649 27/77 (35%)
TOC120NP_188284.1 MDN1 <13..386 CDD:227596
3a0901s04IAP86 333..1088 CDD:273381 37/135 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.