DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep4 and Septin12

DIOPT Version :9

Sequence 1:NP_573147.2 Gene:Sep4 / 32646 FlyBaseID:FBgn0259923 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006522640.1 Gene:Septin12 / 71089 MGIID:1918339 Length:362 Species:Mus musculus


Alignment Length:325 Identity:132/325 - (40%)
Similarity:208/325 - (64%) Gaps:14/325 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PIYPKPKTPSFDKDRDY--IGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLY 111
            |...:|.:|....:..:  :|...:.:|:..|::|.||||.:||||:|||||||::|:||...::
Mouse     9 PCSSRPSSPRTPPNEMFGPVGIEAVLDQLRIKAMKTGFEFNIMVVGQSGLGKSTMVNTLFKSKVW 73

  Fly   112 KNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQ 176
            ::.: ||::..:.:|.::...|..|||:|::|:|||.|||||||.||.:..|.....||::|:.|
Mouse    74 QSTE-PNLDVPMPQTLELHSVTHVIEEKGLKLKLTVTDTPGFGDQINNDKCWDPILSYINQQYEQ 137

  Fly   177 YFTDESGLNR-RNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEV 240
            |..:|..:.| |:|.|.|||||:|||||.||.||.:|::.:|||.|.||:|.||.:||.|..:|.
Mouse   138 YLQEELLITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLRRLCRTVNVVPVIARADSLTIEER 202

  Fly   241 RKLKERILQDLEDNHIQLYQFPECDSDEDDDFKQQDRELKASIPFAVVGSNTILEVAGKKVRGRQ 305
            ...:.||.|:|:.:.|.:|  |:...|||.:.:..:.:::..|||||||::....|.|:.|.||:
Mouse   203 DAFRSRIQQNLKTHCIDVY--PQKCFDEDVNDRLLNSKIREQIPFAVVGADREHIVNGRCVLGRK 265

  Fly   306 YPWGVVN-----VEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERG 365
            ..||::.     ||:..|.:|:.||..||.:|:|||||.|.:|||||:|   :.::::..:..||
Mouse   266 TKWGIIEGPCLAVENMAHCEFLLLRDLLIRSHLQDLKDITHNVHYENYR---VLRLNESHVLPRG 327

  Fly   366  365
            Mouse   328  327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep4NP_573147.2 CDC3 65..420 CDD:227352 129/309 (42%)
CDC_Septin 82..357 CDD:206649 123/280 (44%)
Septin12XP_006522640.1 CDC_Septin 45..320 CDD:206649 123/280 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.