DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep4 and SEPTIN6

DIOPT Version :9

Sequence 1:NP_573147.2 Gene:Sep4 / 32646 FlyBaseID:FBgn0259923 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_011529619.1 Gene:SEPTIN6 / 23157 HGNCID:15848 Length:526 Species:Homo sapiens


Alignment Length:385 Identity:145/385 - (37%)
Similarity:219/385 - (56%) Gaps:54/385 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YIGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTT-- 127
            ::||.:||:|:..|||.:||.|.::.|||:|||||||:::||           |.:...|..|  
Human    22 HVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLF-----------NTKFEGEPATHT 75

  Fly   128 ----KVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNR-- 186
                :::..|.|::|..|||:||:|.|.||||.||.|||::...::||.||..|..:|..:.|  
Human    76 QPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL 140

  Fly   187 RNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDL 251
            ....|:|:|.||||:.|.||||:.:||..:::|..||||:.:|.|||.::|.|:.|.|.:|..:|
Human   141 HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSEL 205

  Fly   252 EDNHIQLYQFPECDSDEDDDFKQQDRELKASIPFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDP 316
            ..|.:|:||||    .:|:...:.:..:.|.:||||:||...|::..|.:|.||||||.|.||:.
Human   206 VSNGVQIYQFP----TDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENE 266

  Fly   317 EHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRD------SISST 375
            .|.||:|||..||..:|:||::.|...|||.:| :|       .|.|.|....|      |:..|
Human   267 AHCDFVKLREMLIRVNMEDLREQTHTRHYELYR-RC-------KLEEMGFKDTDPDSKPFSLQET 323

  Fly   376 NGFDAAISETDRLLLQKDEEIRRM---------------QDMLTQMQEKLKQTHLMEMKK 420
              ::|..:|....|.:|:||:|:|               :..|.:..::||:.|..|.||
Human   324 --YEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep4NP_573147.2 CDC3 65..420 CDD:227352 143/383 (37%)
CDC_Septin 82..357 CDD:206649 116/282 (41%)
SEPTIN6XP_011529619.1 CDC3 21..373 CDD:227352 140/375 (37%)
CDC_Septin 39..307 CDD:206649 118/290 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.