DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Septin4 and unc-61

DIOPT Version :10

Sequence 1:NP_573147.2 Gene:Septin4 / 32646 FlyBaseID:FBgn0259923 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_872156.2 Gene:unc-61 / 179976 WormBaseID:WBGene00006795 Length:530 Species:Caenorhabditis elegans


Alignment Length:34 Identity:11/34 - (32%)
Similarity:14/34 - (41%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CNKDKTLDGRITDVED--VVTEDVGRDHPNQVAL 42
            |.|.....|..|..||  :|:..:...|.|..||
 Worm     7 CEKMGLKRGPWTPEEDQILVSFILNHGHSNWRAL 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Septin4NP_573147.2 CDC_Septin 82..357 CDD:206649
unc-61NP_872156.2 CDC_Septin 165..434 CDD:206649
DUF5401 <380..530 CDD:375164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.