DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep4 and LOC102550225

DIOPT Version :9

Sequence 1:NP_573147.2 Gene:Sep4 / 32646 FlyBaseID:FBgn0259923 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_038954020.1 Gene:LOC102550225 / 102550225 RGDID:7746684 Length:384 Species:Rattus norvegicus


Alignment Length:339 Identity:150/339 - (44%)
Similarity:224/339 - (66%) Gaps:26/339 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGF 153
            ||||||||.||||||||||.||| :.:.|....||:||.:||:..:.::|.||:..||:|||||.
  Rat     1 MVVGESGLEKSTLINSLFLTDLY-SLEYPGPSRRIKKTVQVEQSKVLVKEGGVQSLLTIVDTPGL 64

  Fly   154 GDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRR 218
            |.|::..:.|:....|||.:|..|...||.:|||.:.||||.|||||:.|.||.|:.:|::.::|
  Rat    65 GGAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKSLDIEFMKR 129

  Fly   219 LHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECDSDEDDDFKQQDRELKASI 283
            ||.||||:.:|.|||.|..:|.::.|::|:::::::.|::|:|||.|.:|::...   :::|..:
  Rat   130 LHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLV---KKIKDRL 191

  Fly   284 PFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENF 348
            |.||||||||:||.||:||||||||||..||:.||.||..||..||.||||||||.|.:|||||:
  Rat   192 PLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENY 256

  Fly   349 RAQCISQISQHAL---RERGKLKRDSISSTNGFDAAISETDRLLLQKDEEIRRMQDMLTQMQEKL 410
            |::.::.::.:.:   :.:|:|                 |...|:|.:||.|.....:.:|:.::
  Rat   257 RSRKLAAVTYNGVDNNKNKGQL-----------------TKSPLVQMEEERREHVAKMKKMEMEM 304

  Fly   411 KQTHLMEMKKNDSV 424
            :|  :.|||..:.|
  Rat   305 EQ--VFEMKVKEKV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep4NP_573147.2 CDC3 65..420 CDD:227352 148/333 (44%)
CDC_Septin 82..357 CDD:206649 136/267 (51%)
LOC102550225XP_038954020.1 CDC_Septin 1..264 CDD:206649 136/266 (51%)
DUF4670 <275..380 CDD:406200 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D452703at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.