DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sing and Cmtm8

DIOPT Version :10

Sequence 1:NP_573146.1 Gene:sing / 32644 FlyBaseID:FBgn0261245 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_942049.1 Gene:Cmtm8 / 301045 RGDID:735040 Length:173 Species:Rattus norvegicus


Alignment Length:151 Identity:36/151 - (23%)
Similarity:59/151 - (39%) Gaps:25/151 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FVLSRIGLLKLMQLGLAMLCEGLLIRYGVPYADSIGQALTSFLATTGHCFTTTGILLLCYAFSDK 94
            |:.:..|||.:.::.|.:|...|:.  |..|..........|:|.  ..:..|...|:.|.  ..
  Rat    36 FLRTPPGLLIIAEIVLGLLVWTLIA--GTEYFRVPAFGWVMFVAV--FYWVLTVFFLIVYI--TM 94

  Fly    95 SYSLIRQSLFETL---FNGLASCMYFSSSSYMGFACVVWLHPQFLVRPGF----WAYPAMTACYY 152
            :|:.|.|..:.|:   |||.|..:|||       |.:|........:.|.    ||     |..:
  Rat    95 TYTRIPQVPWTTVGLCFNGSACALYFS-------AAIVDASSVSPEKEGHNFNSWA-----ASSF 147

  Fly   153 MGYAAGILHALDAYLAFRHFR 173
            ..:...|.:|.:.|.:|..:|
  Rat   148 FAFLVTICYAGNTYFSFIAWR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
singNP_573146.1 MARVEL 30..167 CDD:366555 33/143 (23%)
Cmtm8NP_942049.1 MARVEL 36..162 CDD:366555 33/143 (23%)

Return to query results.
Submit another query.