DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sing and M60.4

DIOPT Version :9

Sequence 1:NP_573146.1 Gene:sing / 32644 FlyBaseID:FBgn0261245 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001024815.1 Gene:M60.4 / 187465 WormBaseID:WBGene00019780 Length:162 Species:Caenorhabditis elegans


Alignment Length:105 Identity:17/105 - (16%)
Similarity:39/105 - (37%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 INFGFVLSRIGLLKLMQLGLAMLCEGLLIRYGVPYADSIGQALTSFLATTGHCFTTTGILLLCYA 90
            :|..::.:..|::|::|:....:...||...........|:....|.:..........|:|....
 Worm    29 LNTHYLSTNRGIIKILQIIAGFIICSLLCSQWYGGRSCFGEGRLGFSSGLNFVCVIVNIVLFILN 93

  Fly    91 FSDKSYSLIRQSLFETLFNGLASCMYFSSSSYMGFACVVW 130
            |.:     ||....|.::..:.:.::..:|     ..:||
 Worm    94 FLN-----IRAWGLERIYTVICTILFLIAS-----ILIVW 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
singNP_573146.1 MARVEL 30..167 CDD:307448 16/101 (16%)
M60.4NP_001024815.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22776
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.