DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15865 and tmem102

DIOPT Version :10

Sequence 1:NP_573143.1 Gene:CG15865 / 32641 FlyBaseID:FBgn0015336 Length:1084 Species:Drosophila melanogaster
Sequence 2:XP_031755503.1 Gene:tmem102 / 101730413 XenbaseID:XB-GENE-22069283 Length:409 Species:Xenopus tropicalis


Alignment Length:44 Identity:10/44 - (22%)
Similarity:21/44 - (47%) Gaps:3/44 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KAKGDCFDLTKRKVPLKCRACRHQKCISVGMNPLAMEVDEKAAS 127
            :.:..|.::.::|.  ||.. :|..|:....:.|:...|:|..|
 Frog    44 RCRKSCKEIERKKE--KCGE-KHICCVPKEKDKLSHIHDQKETS 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15865NP_573143.1 Mab-21 <472..555 CDD:460873
Mab-21_C 566..656 CDD:466416
tmem102XP_031755503.1 Mab-21_C <300..354 CDD:466416
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.