DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRE5

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_510966.1 Gene:ADGRE5 / 976 HGNCID:1711 Length:835 Species:Homo sapiens


Alignment Length:611 Identity:131/611 - (21%)
Similarity:224/611 - (36%) Gaps:155/611 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EALWLPMVYLVQQQRFFEPHGASPRFLKFLPNTRPTCRKDQTTEIFRSRGANVMLFPNGTLYVRE 143
            |||..|:.:|:..|.............|.||....|......||:              ||.::|
Human   316 EALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTEL--------------TLMIQE 366

  Fly   144 R----ALMVQPSDYC-VDWEVAVVCLNDSQPINALEDPDYAANPLVQQEP-----PKASLRL-SK 197
            |    ..|.|.|... ::|.||.          ..|||..|...::..:.     ..|||.| ||
Human   367 RGDKNVTMGQSSARMKLNWAVAA----------GAEDPGPAVAGILSIQNMTTLLANASLNLHSK 421

  Fly   198 CCGKWGSYNTQLQNCDLQPNHQAAVDG--LLRLSPQLPEGSYQTSYGLPDCGQPGGYSIAG-DWQ 259
                        :..:|:..:::::.|  |.|||  .....:.:.....:...|..::.:. :..
Human   422 ------------KQAELEEIYESSIRGVQLRRLS--AVNSIFLSHNNTKELNSPILFAFSHLESS 472

  Fly   260 DAKLDRNTAMLQLPHKNLSAG-------QYCLEHTQREGEVKIIACQHLFS---SAAGAGIHDGS 314
            |.:..|:.     |.|::..|       .:....:.|.|......||.|.|   |......|..|
Human   473 DGEAGRDP-----PAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSS 532

  Fly   315 IGGTIEQANGQNLQKAVLTGGILVSIVFLSATLVAGFLL--------PAVHHALHWRCQICYVTC 371
            ....:...:.::.:..::|...|...:|.....:..|||        ..:|  ||    :|  .|
Human   533 FAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIH--LH----LC--IC 589

  Fly   372 LLFGK--ILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWW-TFRDFRPSSLE 433
            |..|.  .|..||.....:   ...|..:|..:.:.|||||.|::.....::: ..|.|:...|.
Human   590 LFVGSTIFLAGIENEGGQV---GLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLS 651

  Fly   434 RNQEALRRYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQ-LYCWFDNRNLSIFAYFYGPI 497
                  .|:| .|..:|.||||..|:|.:        ...|:|: .|||.|.....::: |.||:
Human   652 ------TRWL-CLIGYGVPLLIVGVSAAI--------YSKGYGRPRYCWLDFEQGFLWS-FLGPV 700

  Fly   498 GLLLCANIALFVSTTHQLTCGLWK-RDDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGP 561
            ..::..|..:||:|..:||....: ..|:|...:..||....:..:.::|.||:           
Human   701 TFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWV----------- 754

  Fly   562 HGVWFFTD----------LINALQGVFIFIVVGC--QPQVWTACRRIFCPRLRHDITNTTNGVQH 614
            .|::.|.|          ::|.|||.|::: :.|  ..:|....|:..|                
Human   755 FGLFIFDDRSLVLTYVFTILNCLQGAFLYL-LHCLLNKKVREEYRKWAC---------------- 802

  Fly   615 SSSSQGLPSMAGGTEITQNTTTTTTT 640
                    .:|||::.::.|:||:.|
Human   803 --------LVAGGSKYSEFTSTTSGT 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 66/272 (24%)
ADGRE5NP_510966.1 EGF_CA 64..99 CDD:284955
EGF_CA 116..>148 CDD:214542
EGF_CA 160..207 CDD:284955
EGF_CA 209..243 CDD:284955
GPS 493..536 CDD:280071 9/42 (21%)
7tm_2 544..782 CDD:278432 66/275 (24%)
ProP 608..>785 CDD:223553 51/207 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 814..835 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.