DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRE3

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_115960.2 Gene:ADGRE3 / 84658 HGNCID:23647 Length:652 Species:Homo sapiens


Alignment Length:690 Identity:135/690 - (19%)
Similarity:237/690 - (34%) Gaps:202/690 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SPPPTV--KLNKCCHSGEYLNDGTCIAGSEALWLPMVYLVQQQRFFEPHGASPRFLKFLPNTRPT 114
            :||.:|  ..|..|::.|......|:.|                 :..|..:.:|.....||...
Human    72 TPPYSVYCGFNAVCYNVEGSFYCQCVPG-----------------YRLHSGNEQFSNSNENTCQD 119

  Fly   115 CRKDQTTE----------IFRSRGANVMLFPNGTLYVRERALMVQPSDYCVDWEVAVVCLNDSQP 169
            ....:|||          .|.|      |..|.||:..|....:.        ..|...|.|.:.
Human   120 TTSSKTTEGRKELQKIVDKFES------LLTNQTLWRTEGRQEIS--------STATTILRDVES 170

  Fly   170 ---INALEDPDYAANPLVQQEPPKASLRLSKCCG---KWGSYNTQLQNCDLQPNHQAAVDGLLRL 228
               ..||:||:.....:........:..::..|.   |..:.|.|:.:.|::      ...:::.
Human   171 KVLETALKDPEQKVLKIQNDSVAIETQAITDNCSEERKTFNLNVQMNSMDIR------CSDIIQG 229

  Fly   229 SPQLPEGSYQTSYGLPDCGQPGGYSIAGDWQDA----KLDR------NTAMLQL---PHKNLSAG 280
            ..|.|......|           ||..|:..:|    ::|:      |:.::..   |.:|:|..
Human   230 DTQGPSAIAFIS-----------YSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLS 283

  Fly   281 Q---YCLEHTQREGEVKIIACQHLFSSAAGA-GIHDG----SIGGTIEQANGQNLQK-AVLTG-- 334
            :   ...:|.:.....|.:.|.:..|:..|: ...||    .:..:....|..:|.. |||..  
Human   284 KSVTLTFQHVKMTPSTKKVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALT 348

  Fly   335 --------------GILVSIVFLSATLVAGFLLPAVHH---ALHWRCQIC-YVTCLLFGKILLAI 381
                          |:.||::.|....:...|..|:.:   :||.:..:| ::..|||   |:.|
Human   349 SQEEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLF---LVGI 410

  Fly   382 EELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDF---RPSSLERNQEALRRYL 443
            :.....:     .|..:|..:.:.:||||.|:.....:::.|.|:.   ..||:.|    |.:::
Human   411 DRTEPKV-----LCSIIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINR----LMKWI 466

  Fly   444 YSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLY-----CWFDNRNLSIFAYFYGPIGLLLCA 503
            .....:|.|.:...::|.            .:..||     ||. :.:......|.||:..:..|
Human   467 MFPVGYGVPAVTVAISAA------------SWPHLYGTADRCWL-HLDQGFMWSFLGPVCAIFSA 518

  Fly   504 NIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRV------CLKLVVVMGVTWIADILSWLVGGPH 562
            |:.||:     |...:.||.....:||.|.:...      ....:.::|.||   .|..|..||.
Human   519 NLVLFI-----LVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFILGCTW---CLGLLQVGPA 575

  Fly   563 G---VWFFTDLINALQGVFIFIV-------VGCQPQVWTACRRIFCPRLRHDITNTTNGVQHSSS 617
            .   .:.|| :||:|||.|||:|       |..|.|.|.                          
Human   576 AQVMAYLFT-IINSLQGFFIFLVYCLLSQQVQKQYQKWF-------------------------- 613

  Fly   618 SQGLPSMAGGTEITQNTTTTTTTTNTTATHMPSNPAEDEV 657
                      .||.::.:.:.|.|.::.....|.|:|.:|
Human   614 ----------REIVKSKSESETYTLSSKMGPDSKPSEGDV 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 64/287 (22%)
ADGRE3NP_115960.2 EGF_CA 67..104 CDD:238011 8/48 (17%)
GPS 304..344 CDD:280071 8/39 (21%)
7tm_4 353..594 CDD:304433 61/274 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.