DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and adgrg3

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_021333690.1 Gene:adgrg3 / 799479 ZFINID:ZDB-GENE-140106-110 Length:420 Species:Danio rerio


Alignment Length:441 Identity:93/441 - (21%)
Similarity:154/441 - (34%) Gaps:114/441 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 SIAGDWQDAKLDRNTAM-LQLPHKNLSAGQYCLEHTQREGEVKIIACQHLFSSAAGAGIHDG--- 313
            |:.|.|.......|.:. :||..:|        .|.|.|..:.:.  .||..:..|....||   
Zfish    44 SVLGVWLGTTEVNNLSQPVQLKFRN--------THNQTENGICVY--WHLEKNGGGNWSTDGCKT 98

  Fly   314 --SIGGTIEQANGQNLQKAVLTG-----------------GILVSIVFLSATLVAGFLL---PAV 356
              ..|..:...|..:....:::.                 |..:||.|.|..:|. ||.   ...
Zfish    99 NIDNGDFVCSCNHLSFFAVLISPQIPEKSHIVHLNYISYVGSALSIAFTSLVIVL-FLCQRKKQC 162

  Fly   357 HHALHWRCQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFW--------- 412
            .|:|....|:.  :||....|........|......:.|.|:.:.:.:..||.|.|         
Zfish   163 EHSLVIHVQLS--SCLFLLHISFLCSVWFSGHSDSDSVCQTIGLLLHWCLLATFTWTAIEGFHLY 225

  Fly   413 -LNTMCFNIWWTFRDFRPSSLERNQEALRRYL--YSLYAWGGPLLITFVAACVDQLPETTLL--- 471
             |....|||:                 ::||:  .||..||.|.:...:........:.||.   
Zfish   226 LLLVRVFNIY-----------------IKRYMLKLSLMGWGVPTVTAMICGMTKVYGKYTLYTDQ 273

  Fly   472 RPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALF---VSTTHQLTCGLWKRDDVKSSSEKSA 533
            ........||. ..|..|:....|.:||::..|:|:.   |....||     ::.:|:...:|.|
Zfish   274 ENSTATSLCWV-TTNTVIYITVNGYLGLVMLFNMAMLAVVVVKMRQL-----RQQNVQIDHQKRA 332

  Fly   534 LGRVCLKLV---VVMGVTWIADILSWLVGGP---HGVWFFTDLINALQGVFIFIVVGCQPQVWTA 592
             .:.|:.|:   .|:||.|   .|::...||   ..::.|| ::|:.||||||:        |..
Zfish   333 -WKDCVSLLGLCFVLGVPW---GLAFSTHGPLSLPALYVFT-ILNSFQGVFIFL--------WIL 384

  Fly   593 CRRIFCPRLRHDITNTTNGVQHSSSSQGLPSMAGGTEITQNTTTTTTTTNT 643
              .:.|...:...|::...:|.|             .::.....|:.|||:
Zfish   385 --TLTCKARKEKQTSSKGTIQVS-------------YLSNEEYVTSKTTNS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 64/293 (22%)
adgrg3XP_021333690.1 GPS 77..118 CDD:307782 7/42 (17%)
7tm_GPCRs 132..393 CDD:333717 69/301 (23%)
TM helix 1 132..156 CDD:320095 7/24 (29%)
TM helix 2 166..187 CDD:320095 5/22 (23%)
TM helix 3 200..222 CDD:320095 5/21 (24%)
TM helix 4 242..258 CDD:320095 5/15 (33%)
TM helix 5 287..310 CDD:320095 7/22 (32%)
TM helix 6 333..358 CDD:320095 7/27 (26%)
TM helix 7 362..387 CDD:320095 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.