DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and Adgrf1

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_006525183.1 Gene:Adgrf1 / 77596 MGIID:1924846 Length:927 Species:Mus musculus


Alignment Length:561 Identity:118/561 - (21%)
Similarity:208/561 - (37%) Gaps:180/561 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GANVMLFPN-------GTLYVRERALM--VQPSDYCVD------WEVAVVCLND--SQPINALED 175
            |:.|.|..|       .:|.|....||  :..:|:.:|      |.:.:....|  ||.:..|| 
Mouse   364 GSVVSLLSNISSLSLANSLTVSNLTLMNVINIADHILDSASITNWTILLQDAKDASSQLLKTLE- 427

  Fly   176 PDYAANPLVQQEPPKASLRLSKCCGK---W-GSYNTQLQN-------CDLQPNHQAAVDGLLRLS 229
               :.:.|:    |..:|.|: ..||   | |:..||:|:       .:::.|....:.|.:.:.
Mouse   428 ---SISSLI----PSMALPLN-FSGKFIDWKGTPVTQIQSTRGYNYQMEMRQNASLPIRGHVFIE 484

  Fly   230 PQLPEGSY--------QTSYG--LPDCGQPG--------------GYSIA----------GD--- 257
            |...:.|:        ..::|  || ..|.|              .|||:          |:   
Mouse   485 PDQFQKSHPKTIISMASLTFGDILP-ITQRGNAWVNGPVISTLIQNYSISEIFLNFSKIKGNLTQ 548

  Fly   258 -----WQDAKLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKIIACQHLFSSAAGAGIHDGSIGG 317
                 |..::|..:.|..||.::.|              :..:..|.||.|.:.           
Mouse   549 PRCVFWDFSQLQWSNAGCQLVNETL--------------DTVLCRCSHLTSFSM----------- 588

  Fly   318 TIEQANGQNLQKAVLTGGIL-----VSIVFLSATLVAGFLLPAVHHALHW----RCQICYV--TC 371
                     |....:...::     ::.:.||.: :|..:|..:..:|.|    |.|..|.  .|
Mouse   589 ---------LMSPFVPSSVVPVVKWITYIGLSIS-IASLILCLIIESLFWKQTKRSQTSYTRNIC 643

  Fly   372 LLFGKILLAIEE----LSSSLQPG---SAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRP 429
            |:...:.|.|.:    :::::.|.   |..|........||:||.|||:  :...|...:|..  
Mouse   644 LVNIAVSLLIADVWFIIAATVDPSVSPSGVCVAAVFFTHFFYLAVFFWM--LVLGILLAYRII-- 704

  Fly   430 SSLERNQEALRRYL---YSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLYCW--FDNRNLSI 489
              |..:..||...:   :.| .:|.||||:.:...|.| |..:..|..    .||  :.:::..:
Mouse   705 --LVFHHMALTTMMAIGFCL-GYGCPLLISIITLAVTQ-PSNSYKRND----VCWLNWSDKSKPL 761

  Fly   490 FAYFYGPIGLLLCANIALFVSTTHQLTCGLWK-------RDDVKSSSEKSALGRVCLKLVVVMGV 547
            .| |..|...::..|:.:.:....:    ||:       ..|.|:::.:  :|:..|.|..::|:
Mouse   762 LA-FVVPALTIVAVNLVVVLLVLRK----LWRPAVGERLNQDDKATAIR--MGKSLLVLTPLLGL 819

  Fly   548 TWIADI--------LSWLVGGPHGVWFFTDLINALQGVFIF 580
            ||...|        |:|.|       .|. |:||.||.|||
Mouse   820 TWGFGIGTMANSHNLAWHV-------LFA-LLNAFQGFFIF 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 64/287 (22%)
Adgrf1XP_006525183.1 SEA 172..258 CDD:366610
GPS 549..590 CDD:197639 10/74 (14%)
7tm_GPCRs 603..866 CDD:391938 67/278 (24%)
TM helix 1 603..626 CDD:341315 4/23 (17%)
TM helix 2 641..663 CDD:341315 4/21 (19%)
TM helix 3 675..702 CDD:341315 8/28 (29%)
TM helix 4 716..736 CDD:341315 6/20 (30%)
TM helix 5 757..786 CDD:341315 4/33 (12%)
TM helix 6 803..829 CDD:341315 7/27 (26%)
TM helix 7 834..859 CDD:341315 12/27 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.