DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and CG42402

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001287642.1 Gene:CG42402 / 7354470 FlyBaseID:FBgn0259821 Length:747 Species:Drosophila melanogaster


Alignment Length:296 Identity:64/296 - (21%)
Similarity:91/296 - (30%) Gaps:116/296 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 SLERNQEALRRYLYSLYAWGGPLLITFV----------------------AACVDQLPETTL--- 470
            |||.:||.|..||.:|.:.|  :||:.|                      |....::.|||:   
  Fly   459 SLEEDQERLYFYLLALVSLG--VLISIVIFGTRIALQKHHLVTETLSSSFAKTTRRVEETTIPSG 521

  Fly   471 LRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALG 535
            |.....::....|.:...       |:..|......|..:.|..|...|.:...|.:.|:.||.|
  Fly   522 LNDTISEIDAEIDLKTTL-------PLPNLSNKENYLTYAPTSSLYADLPRNQLVSACSQGSAAG 579

  Fly   536 RVCLKLVVVMGVTWIADILSWLVGGPH--GVWFFTDLINALQGVFI------------------- 579
            :                     :|.||  |.....|||...||.|:                   
  Fly   580 Q---------------------IGKPHIVGTRQSPDLIGITQGPFVTTSMASLGGQGPMAAMVTS 623

  Fly   580 FIVVGCQPQVWTACRRIFCPRLRHDITNTTNGVQHSSSSQG----------LPSMAGGTEITQNT 634
            .||:|                     .:|.|     |||.|          .|::.||..|:.:.
  Fly   624 AIVIG---------------------DSTPN-----SSSLGAMIPITQYTTAPTIRGGYVISADN 662

  Fly   635 TTTTTTTNTTATHMPSNPAEDEVPEKAPIAPVAPIV 670
            .......|.|.|  |.|......||:.|.|  .||:
  Fly   663 MGVIQRANNTPT--PLNLLSGSTPEQPPQA--GPII 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 39/174 (22%)
CG42402NP_001287642.1 Gal_Lectin <181..259 CDD:280328
Gal_Lectin 277..359 CDD:280328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.