DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and ADGRL4

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_071442.2 Gene:ADGRL4 / 64123 HGNCID:20822 Length:690 Species:Homo sapiens


Alignment Length:316 Identity:74/316 - (23%)
Similarity:121/316 - (38%) Gaps:88/316 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 CQH------LFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLTGGILVSIVFLSATLVAGFLL--- 353
            |.|      |.||....||.|.:|...|.|.            ||::|::.|:..:...:..   
Human   403 CNHLTHFAILMSSGPSIGIKDYNILTRITQL------------GIIISLICLAICIFTFWFFSEI 455

  Fly   354 ----PAVHHALHWRCQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLN 414
                ..:|..|   |...::..|:|   |:.|...::.|     .|..:|..:.:||||||.|  
Human   456 QSTRTTIHKNL---CCSLFLAELVF---LVGINTNTNKL-----FCSIIAGLLHYFFLAAFAW-- 507

  Fly   415 TMCFNIWWTFRDFRPSSLERNQEALRRYL---------------YSLYAWGGP-LLITFVAACVD 463
             ||.                  |.:..||               :.::.:..| :::.|.||...
Human   508 -MCI------------------EGIHLYLIVVGVIYNKGFLHKNFYIFGYLSPAVVVGFSAALGY 553

  Fly   464 QLPETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALF---VSTTHQLTCGLWKRDDV 525
            :...||.:        ||....|..|:: |.||..|::..|:..|   :....:.|.||  :.:|
Human   554 RYYGTTKV--------CWLSTENNFIWS-FIGPACLIILVNLLAFGVIIYKVFRHTAGL--KPEV 607

  Fly   526 KSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHGVWFFTDLINALQGVFIFI 581
            .......:..|..|.|:.::|.|||..:|..:.......:.|| :.||.||:|||:
Human   608 SCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFT-VSNAFQGMFIFL 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 60/275 (22%)
ADGRL4NP_071442.2 EGF_CA 58..>91 CDD:284955
GAIN 139..330 CDD:293098
GPS 368..412 CDD:280071 2/8 (25%)
7tm_4 424..660 CDD:304433 63/291 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.