DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and adgrf7

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_017208207.1 Gene:adgrf7 / 613165 ZFINID:ZDB-GENE-041001-214 Length:694 Species:Danio rerio


Alignment Length:227 Identity:53/227 - (23%)
Similarity:93/227 - (40%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 CLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLERN 435
            |.:.|..:|..|:|:.     :..|.::...|.||:||.|||:......:::..    ...|.:.
Zfish   464 CFIIGAAILDEEQLTP-----ADRCSSVVFFMHFFYLALFFWMLISALLLFYRV----VMVLSQM 519

  Fly   436 QEALRRYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLY-----CWF---DNRNLSIFAY 492
            ..|....:..|..:|.||||:.:.......|          |:|     ||.   ::|||..|..
Zfish   520 SRAKMMVISFLLGYGAPLLISVITVASTVGP----------QMYVSKQACWLNWNESRNLLAFVI 574

  Fly   493 FYGPIGLLLCANIALFVSTTHQL---TCGLWKRDDVKSSSEKSALGRVCLKL---VVVMGVTWIA 551
               |...::..|:.:|:...:::   ..|...:.|.|::   ..:.| |:..   .:..|:||..
Zfish   575 ---PALTIVAINLVVFIVVLYKIFKRRAGAATQPDWKNA---LVVAR-CVAFFTPALACGITWGF 632

  Fly   552 DILSWLVGG--PHGVWFFTDLINALQGVFIFI 581
            .|.:.:..|  .|.|:   .|.|:|||.||.:
Zfish   633 GIGTTVSAGLFVHVVF---ALFNSLQGFFILV 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 51/223 (23%)
adgrf7XP_017208207.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.