DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and adgre10

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_021333746.1 Gene:adgre10 / 569655 ZFINID:ZDB-GENE-090313-152 Length:690 Species:Danio rerio


Alignment Length:262 Identity:64/262 - (24%)
Similarity:111/262 - (42%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 ILVSIVFLSATLVAGFLL----PAVHHALHWRCQICYVTCLLFGKILLAIEELSSSLQPGSAACH 396
            ::|.:||.|..|:: |.|    |.|::..  |..|| ::.|....:||..::..|.::|....|.
Zfish   421 VIVGLVFFSLALLS-FALCQWSPGVNNVA--RINIC-ISLLSAHLLLLLTQQFLSLIRPQQVLCV 481

  Fly   397 TLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLERNQEALRRYLYSLYAWGGPLLITFVAAC 461
            .:|..:.|.||:||.|:......::...::....| .|.:|.|..        |...:|.:|.|.
Zfish   482 VIAGLLHFLFLSAFVWMFIEAVLLFICVKNLSQVS-SRKKEVLSN--------GFLCVIGYVVAL 537

  Fly   462 VDQLPETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLWKRD-DV 525
            :.......::..|:|...||. ..:...|..|.||:.::|..|:.||:|.:..|...|.|.: :|
Zfish   538 IGVSVSIGMVPEGYGSEQCWI-KMDKGFFWSFLGPVCVILGLNVILFISISIYLNSALKKLNAEV 601

  Fly   526 KSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHGVWFFTD----------LINALQGVFIF 580
            ....:...:....|...|::|..||             :.||..          :||:.||.|||
Zfish   602 SQLKQTKVMVFKTLGQFVILGCPWI-------------LGFFAHVNMVVEIVFIIINSQQGTFIF 653

  Fly   581 IV 582
            ::
Zfish   654 LI 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 61/257 (24%)
adgre10XP_021333746.1 GPS 360..406 CDD:197639
7tm_GPCRs 413..672 CDD:333717 64/262 (24%)
TM helix 1 413..437 CDD:320095 6/16 (38%)
TM helix 2 446..467 CDD:320095 6/23 (26%)
TM helix 3 481..503 CDD:320095 7/21 (33%)
TM helix 4 527..543 CDD:320095 3/15 (20%)
TM helix 5 561..584 CDD:320095 7/22 (32%)
TM helix 6 608..631 CDD:320095 6/35 (17%)
TM helix 7 635..660 CDD:320095 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.