DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and adgrg11

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_017208200.1 Gene:adgrg11 / 563883 ZFINID:ZDB-GENE-041210-320 Length:793 Species:Danio rerio


Alignment Length:461 Identity:85/461 - (18%)
Similarity:154/461 - (33%) Gaps:118/461 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 INALEDP----DYAANPLVQQEPPKASLRLSKCC----GKWGSYNTQLQNCDLQPNHQAAVD--- 223
            :..::||    :|....:|.:|..:.:|..|...    .::.:.:....|.|:..|...|::   
Zfish   370 VRLIDDPTVLKNYPNALIVPKEAAQQALNQSSNAFLGVFRFPNMSKDANNSDVLNNEVYAIEMGT 434

  Fly   224 ------GLLRLSPQLPEGSYQTSYGLPDCGQPGGYSIAGDWQDAKLDRNTAMLQLPHKNLSAGQY 282
                  ..:.||..:.    |::.|.|.|....|.....||                    ..:.
Zfish   435 KIKNLSNTINLSFNMS----QSTSGTPTCYSWDGNGSKPDW--------------------TTEG 475

  Fly   283 CLEHTQREGEVKIIACQHLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLTG-------GILVSI 340
            |  .|...|......|:||...|......|            ..|:::.||.       |..:|:
Zfish   476 C--RTVVNGSGITCKCEHLTFFAVLMAPPD------------ITLRESDLTALTYITYIGCGLSM 526

  Fly   341 VFLSATLVAGFLL------PAVHHALHWRCQICYVTCLLFGKILLAIEELSSSL---QPGSAACH 396
            .||...|...||:      .:||..::          |.....:|.:..|::..   ...|..|.
Zfish   527 FFLGVGLFMHFLMRKAKATNSVHVLIN----------LFLALFMLNVAFLTNEYVVQAQNSILCR 581

  Fly   397 TLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLERNQEA-LRRYL--YSLYAWGGPLLITFV 458
            .:|..:.:..|::|.|......::          .|:..:.| |:.||  .::..|..|..:..|
Zfish   582 VMAAFLHYCLLSSFTWFAVEALHL----------CLQMTKTATLKHYLLKITVAGWAPPAFVVSV 636

  Fly   459 AACVDQLPETTLLRPGFGQLYCWFDNR------NLSIFAY-FYGPIGLLLCANIALFVSTTHQLT 516
            ...:.:..|..::........||..:.      |:..:.: |...:|..:     :.|.....|.
Zfish   637 IFSLGKYGEDNIMTESRNVTMCWIVDSTVHYVVNIGYYCFVFTFTLGTFI-----VVVRWLSMLR 696

  Fly   517 CGLW------KRDDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHGVWFFTDLINALQ 575
            ...|      ||....:|...:.||..||     :|:||.....|:........:.|| ::|:||
Zfish   697 MSKWSKDGKVKRSGTATSDISTMLGLCCL-----LGLTWGISFFSYGALRMPSYYIFT-ILNSLQ 755

  Fly   576 GVFIFI 581
            |.|:|:
Zfish   756 GFFLFV 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 54/281 (19%)
adgrg11XP_017208200.1 GPS 457..498 CDD:280071 12/62 (19%)
7tm_4 511..759 CDD:304433 54/278 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.