DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and adgrl1a

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_021330394.1 Gene:adgrl1a / 562531 ZFINID:ZDB-GENE-131127-267 Length:1524 Species:Danio rerio


Alignment Length:564 Identity:129/564 - (22%)
Similarity:209/564 - (37%) Gaps:147/564 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SDYCVDWEVAVVCLN---DSQPINALEDPDYAANPLVQQEPPKASLRLSKCCGKWGSYNTQL--- 209
            ||:..:.::.|..||   |||.::           ..|..|..:|::||....|..|.|.|:   
Zfish   668 SDHAANVDLEVRVLNTETDSQDLS-----------FPQSGPSDSSIQLSASTFKQYSRNGQVKVV 721

  Fly   210 -------------QNCDLQPNHQAAVDGL-LRLSPQLPEGSYQ---------------------T 239
                         :|..::...:|.:.|. |.::..:...|..                     .
Zfish   722 FVLYKNLGSFLSTENATVKMEMEAGIGGRGLAVNSHVIAASINKESSRVFLTEPVVFTLRHLQLE 786

  Fly   240 SYGLPDCG--QPGGYSIAGDWQDAKLDRNTAMLQLPHKNLSAGQYCLE----HTQREGEVKIIAC 298
            ::..|:|.  .....|:.|.|.                  |.|...:|    ||       ..:|
Zfish   787 NHFSPNCSFWNYSERSMTGQWS------------------SQGCRLIETNSTHT-------TCSC 826

  Fly   299 QHLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLTG-GILVSIVFLSATLVAGFL----LPAVHH 358
            .||.:.|.....|:....|.:.:     |...|:|. ||::|:|.| |..::.|.    |....:
Zfish   827 SHLTNFAVLMVHHEPDYPGRMHE-----LILFVITWVGIVISLVCL-AICISTFCFLRGLQTDRN 885

  Fly   359 ALHWR-CQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWW 422
            .:|.. |...::..|||   |:.|::....:     ||...|..:.|||||||.|:......::.
Zfish   886 TIHKNLCINLFIAELLF---LIGIDKTQYHI-----ACPIFAGLLHFFFLAAFSWMCLEGIQLYL 942

  Fly   423 TFRDFRPSSLERNQEALRRYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLYCWFDNRNL 487
            ...:...|...|     ::|.| |..:..|.|:..::|.:|.....|       :..||....|.
Zfish   943 MLVEVFESEYSR-----KKYYY-LCGYCFPALVVGISAAIDYRSYGT-------KKACWLRVDNY 994

  Fly   488 SIFAYFYGPIGLLLCANIALFVSTTHQL--TCGLWKRDDVKSSSEKS-ALGRVCLKLVVVMGVTW 549
            .|:: |.||:..::..|:...:.|.|::  .....|.|..:..:.|| |||.:.  |:.::|:||
Zfish   995 FIWS-FIGPVSFIIMLNLVFLMITLHKMIRNSSALKPDSSRLDNIKSWALGAIA--LLFLLGLTW 1056

  Fly   550 IADILSWLVGGPHGVWFFTDLINALQGVFIFIV-VGCQPQV---WTACRRIFCPRLRHDI----T 606
            ...:|..........:.|| ..||.||:||||. ...|.:|   ::.|       |||..    |
Zfish  1057 AFGLLFINENTVIMAYLFT-TFNAFQGMFIFIFHCALQKKVHKEYSKC-------LRHSYCCSRT 1113

  Fly   607 NTTNGVQHSSSSQGLPSMAGGTEITQNTTTTTTTTNTTATHMPS 650
            :||       ||.|  |:......|.|...|.:.|...|.|..|
Zfish  1114 STT-------SSHG--SLKNSALRTNNRYYTGSQTRHAAVHRQS 1148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 66/258 (26%)
adgrl1aXP_021330394.1 Gal_Lectin 48..128 CDD:307994
OLF 142..398 CDD:321983
HormR 474..535 CDD:214468
GAIN 545..765 CDD:318649 22/107 (21%)
GPS 789..836 CDD:197639 14/71 (20%)
7tmB2_Latrophilin-1 849..1106 CDD:320673 75/294 (26%)
TM helix 1 851..876 CDD:320673 9/25 (36%)
TM helix 2 885..907 CDD:320673 6/24 (25%)
TM helix 3 916..943 CDD:320673 9/26 (35%)
TM helix 4 955..975 CDD:320673 5/20 (25%)
TM helix 5 992..1021 CDD:320673 8/29 (28%)
TM helix 6 1037..1064 CDD:320673 10/28 (36%)
TM helix 7 1068..1093 CDD:320673 10/25 (40%)
Latrophilin 1105..1524 CDD:308136 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.