DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and mthl7

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster


Alignment Length:287 Identity:64/287 - (22%)
Similarity:121/287 - (42%) Gaps:56/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 SIVFLSATLVAGFLLPAVH------HALHWRCQIC-----YVTCLLFGKILLAIEELSSSLQPGS 392
            |:..|..|::...|..||:      ..:..:|.:|     ::.||:.  ||..:..|:....|..
  Fly   222 SLEILIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCLIM--ILDHLNLLNGICSPAG 284

  Fly   393 AACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLERNQEALRRYLYSLYAWGGPLLITF 457
            .:.|       ||.:|:..||:.:.::.|...     :||.|.....|...|:.:.|....::|.
  Fly   285 YSSH-------FFRMASNLWLSVISYHTWKVL-----TSLNRVDPNYRFLRYNAFVWSTAAIMTG 337

  Fly   458 VAACVDQL----PETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTT---HQL 515
            ....|:|:    |......|..|.:.|...:.:.|::.|..||...|...|:|:|..|.   .::
  Fly   338 SIYIVNQIWENDPSKWNWLPLVGFIRCSVKDWHPSVWIYISGPSLALSTFNVAMFALTAIYIRKV 402

  Fly   516 TCGLWKRDDVKSSSEKSALGRV-C-----------LKLVVVMGVTWIADILSWLVGGPHGVWFFT 568
            ..|:     .|.::|:.  ||: |           |:|.:|||:|||.:::.: ....|..|.:.
  Fly   403 KGGI-----NKFTNEEE--GRINCINFDSQTYLQFLRLSIVMGLTWIFNVIPY-SARLHIFWEWV 459

  Fly   569 DLI----NALQGVFIFIVVGCQPQVWT 591
            .:|    ::..|:.:|:::..:...||
  Fly   460 GIISEYFHSAFGIVLFVLLVLKRSTWT 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 61/273 (22%)
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462212
Domainoid 1 1.000 49 1.000 Domainoid score I4416
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.