DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and mthl6

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster


Alignment Length:475 Identity:121/475 - (25%)
Similarity:187/475 - (39%) Gaps:114/475 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LNDSQPINALEDPD-----YAANPLV--QQEPPKASLRLSKCCGKWGSYNTQLQNC--------D 213
            ||||.....|..|.     |....|.  .|||.|:.||...|         :|:.|        .
  Fly    39 LNDSYAYEELIIPAHLTGLYTFRQLADGSQEPVKSHLRACIC---------KLKPCIRFCCPRNK 94

  Fly   214 LQPNHQAAVDGLL----RLSP----QLPEGSYQTSYGLPD----------CGQPGGYSIAGDWQD 260
            :.||.:.: |||.    |::|    .|.:|:....|.|.|          |.:.  .|:..|  .
  Fly    95 MMPNSRCS-DGLTENLKRINPYLKITLEDGTIGKYYLLTDMIVLRYEFRYCEKV--VSVQED--Q 154

  Fly   261 AKLDRNTAMLQLPHKN--LSAGQYCLEHTQREGEVKIIACQHLFSSAAGAGIHDGSIGGTIEQAN 323
            .||..|.:.:..|..|  ||...||| |.:.|....|...:|::...:...:..   .|||.   
  Fly   155 YKLYENGSFMIKPDVNWTLSKQWYCL-HPRLEDPNSIWILEHVYIPKSMPAVPQ---VGTIS--- 212

  Fly   324 GQNLQKAVLTGGILVSIVFLSATLVAGFLLPAVHHALHWRCQICYVTCLLFGKILLAIEELSSSL 388
                    :.|.||...|:|....:...|         .:|.||||.|.....::.|    ...|
  Fly   213 --------MVGCILTIAVYLYIKKLRNLL---------GKCFICYVFCKFVQYLIWA----GGDL 256

  Fly   389 QPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLERNQEALRRYLYSLYAWGGPL 453
            ...:..|.....|..||.||:.|||:.|...||...|     .:.|::.:....:|::|.||.|.
  Fly   257 NLWNNICSLAGYTNYFFALASHFWLSVMSHQIWKNLR-----LINRDERSYHFLIYNIYGWGTPA 316

  Fly   454 LITFVAACVD----QLPETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQ 514
            ::|.:...||    ..|:.....||.|...||.:..:.|...|.|||:.:|...|:..|:.|.:.
  Fly   317 IMTAITYLVDWAWEDRPDKLNWIPGVGLYRCWINTYDWSAMIYLYGPMLILSLFNVVTFILTVNH 381

  Fly   515 LTCGLWKRDDVKSSSEKSALGRVC---------LKLVVVMGVTWIADILSWLVGGPHGVW----- 565
            :   :..:..||||:::.   |.|         |:|.|:||||.|::::::.| ..|..|     
  Fly   382 I---MKIKSSVKSSTQQQ---RKCIQNNDFLLYLRLSVMMGVTGISEVITYFV-KRHKFWRQVLR 439

  Fly   566 ---FFTDLINALQGVFIFIV 582
               ||    :...|:.:|::
  Fly   440 VPNFF----HLGSGIVVFVL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 71/270 (26%)
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 46/172 (27%)
7tm_4 211..398 CDD:304433 56/221 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462213
Domainoid 1 1.000 49 1.000 Domainoid score I4416
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.