DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and mthl9

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_612029.1 Gene:mthl9 / 38056 FlyBaseID:FBgn0035131 Length:513 Species:Drosophila melanogaster


Alignment Length:372 Identity:87/372 - (23%)
Similarity:142/372 - (38%) Gaps:93/372 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 WQDAKLDRNTAMLQLPHKNLSAGQYC---LEHTQREGEVKIIACQHLFSSAAGAGIHDGSIGGTI 319
            ||....:..|  |:..::..|..:||   |||...:.|:..:.|:. |.:.....|:  :|...|
  Fly   158 WQWDLFENGT--LRRDNRLWSTDEYCFSPLEHNPEQWELTPLNCER-FQTGYRVWIY--AICSII 217

  Fly   320 EQANGQNLQKAVLTGGILVSIVFLSATLVAGFLLPAVHHA--LHW-RCQICYVTCLLFGKILLAI 381
                           .|:::|..||       ||.:|..|  .|: :..|.|:..::.|..||..
  Fly   218 ---------------AIIINIFILS-------LLGSVRDARKSHYGQLIIYYLLSMIVGYSLLVY 260

  Fly   382 EELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFR-PSSLERNQEALR----- 440
            ..|.:.::....||..:.....|..:.:|.:|.....:....|:... .||:.|...||.     
  Fly   261 LALKNPMKLSHVACRNIGFLAYFCIMLSFVFLAICSLDFLLKFKQKAVRSSVRRLSLALAVLAVI 325

  Fly   441 --RYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLL-- 501
              |:|.||             |...:||:.  .:||.|:.|||||.|...|..|:||||.|||  
  Fly   326 GLRFLVSL-------------AQDSKLPKH--FKPGMGEDYCWFDVRTWGILIYYYGPIALLLIF 375

  Fly   502 ---CANIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRVCLKLV---------VVMGV--TWIAD 552
               |...|.|  :.::|           ....:..|| ..||:|         .::||  .||.:
  Fly   376 SIVCCLKAYF--SIYEL-----------PPDTQYILG-TQLKIVKTHFYAFSAYIVGVFAVWIRE 426

  Fly   553 ILSWLVGGPHGVWFFTDLIN-------ALQGVFIFIVVGCQPQVWTA 592
            |:.:::......:|..|..:       |:.|..:.:......:.|.|
  Fly   427 IVVYIMARVREHFFIIDFWSGICILGLAIAGFILLLGKNLHVKSWWA 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 69/283 (24%)
mthl9NP_612029.1 Methuselah_N 29..199 CDD:284145 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.