DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and mthl8

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster


Alignment Length:448 Identity:90/448 - (20%)
Similarity:153/448 - (34%) Gaps:100/448 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KASLRLSKCCGKWGSYNTQLQNC-------DLQPNHQ----AAVDGLLRLSPQLPEGSYQTSYGL 243
            |..:|:  ||.:...|:.:.:.|       ...|:|.    ...:|.|||....|..|....   
  Fly    87 KPCVRI--CCLRGEIYDLEKRQCLVPVAGVSSLPSHSHMEVELGNGSLRLVKLQPRFSIHVE--- 146

  Fly   244 PDCGQPGGYSIAGDWQDAKLDRNTAMLQLPHKNLSAGQYC---LEHTQREGEVKIIAC--QHLFS 303
            ..|......:...::....|..|..:....|  :.:..||   |.|.....|.:.:||  :.|: 
  Fly   147 TPCEHMKAVTKGSEYVHWTLHENGTISHRGH--IFSKHYCFTPLLHGNSTWEWQPLACAPEKLY- 208

  Fly   304 SAAGAGIHDGSIGGTIEQANGQNLQKAVLTGGILVSIVFLSATLVAGFLLPAVHHALHWRCQICY 368
                      .:.|..|......|..|:|:..|::.:..:.:.:...|...|:.         .|
  Fly   209 ----------FVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFYGVAIK---------AY 254

  Fly   369 VTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRD------- 426
            ..|::.|..|||...|.:.....:|||..|........:.:|:.|:.:.|.::.:|..       
  Fly   255 AICMILGYALLAYLTLHNPANLSNAACRILPSLALMNLVLSFYILSFIAFKLYLSFYGVVFTKLM 319

  Fly   427 ----FRPSSLERNQEALRRYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLYCWFDNRNL 487
                |.|..|    .|:....:..:::.|..||                   ||...||||.||.
  Fly   320 FWLIFTPIVL----VAVGWSFFVGFSYYGSRLI-------------------FGGDTCWFDPRNW 361

  Fly   488 SIFAYFYGPIGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALG------RVCLKLVVVMG 546
            |:..|||.|: .:.||     :|....:...::.||.....:|||...      :...|......
  Fly   362 SVMIYFYAPV-FVACA-----ISGFFYVLSQIYIRDQPDIETEKSFESIEKNRFKSFWKYFGYTA 420

  Fly   547 VTWIADILSWLVGGPHGVW-------FFTDLINALQG-VFIFIVVGCQPQVWTACRRI 596
            |.|:..|.|:..   :..|       :......|..| ..::.::|...|:....|||
  Fly   421 VVWVVCICSFAF---NYYWENRSHLNYAVSFCMAFHGFAALYALIGKNQQIQNFLRRI 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 56/274 (20%)
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 23/121 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.