DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and mthl4

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster


Alignment Length:526 Identity:122/526 - (23%)
Similarity:211/526 - (40%) Gaps:122/526 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PTCRKDQTTEIFRSRGANVMLFPNGTLYVRERALMVQPSDYCVDWEVAVVCLNDSQPINALEDPD 177
            |.|....|.:|     :....|.||: |:.|..|:  |:....:::..::. :||:...|.....
  Fly    21 PGCDFFDTVDI-----SKAPRFSNGS-YLYEGLLI--PAHLTAEYDYKLLA-DDSKEKVASHVRG 76

  Fly   178 YAAN--PLVQQEPPK-ASLRLSKCCGKWGSYNTQLQNCDLQPNHQAAVDGLLRLSPQLPEGS--- 236
            .|.:  |.::...|: ..::.|||.|            |:..:.....|..:.::  |.:||   
  Fly    77 CACHLRPCIRFCCPQYQKMQKSKCYG------------DMSEDELNKHDPFVNVT--LSDGSVVR 127

  Fly   237 --------YQTSYGLPDCGQ--------PGGYSIAGDWQDAKLDRNTAMLQLPHK-NLSAGQYCL 284
                    .|:....|.|.:        ||        .:..|..|.::|:...| .||..:||:
  Fly   128 RHFKEDLIVQSDLAKPGCPRMYFLNHELPG--------NEFTLFENGSLLRHWDKVELSKREYCV 184

  Fly   285 EHTQ-REGEVKI------IACQHLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLTGGILVSIVF 342
            :|.. ::..::|      ::.:|                           .:...|..|::|::.
  Fly   185 QHLSFKDDSIRIAPHFCPLSSEH---------------------------SRTWKTVAIVISLIC 222

  Fly   343 LSATLVAGFLLPAVHHALHWRCQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFL 407
            :..| ::.:|.......||.:|.|||:..|..|...|.:.....|    |..|.|......|..:
  Fly   223 IILT-ISVYLYVEKLRNLHGKCFICYLASLFLGYFFLVLNVWKYS----SGFCVTAGFLGYFSVM 282

  Fly   408 AAFFWLNTMCFNIWWTFRDFRPSSLERNQEALRRYL-------YSLYAWGGPLLITFVAACVDQL 465
            ||||||:.:..::...|      ||..|  .|.|.|       |:|||||.||::|.:....||:
  Fly   283 AAFFWLSVIGIHLRIKF------SLASN--CLHRLLPENPFRAYNLYAWGIPLIMTAITYTADQV 339

  Fly   466 PETTLLRP--GFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQL------TCGLWKR 522
            .:...|||  |.|: .||....::::..|||||:.||:..||.:||.:...:      ..||..:
  Fly   340 VKNEKLRPRVGVGK-NCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHK 403

  Fly   523 DDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHGVW----FFTDLINALQGVFIFIVV 583
            ...........:..:.|:|.::||::|..:|||:|: .....|    ...|..|..||..||::.
  Fly   404 QQTNQQINDQQMFAIFLRLFILMGLSWSFEILSFLL-TKQQAWARALMVADYFNWSQGTIIFVLF 467

  Fly   584 GCQPQV 589
            ..:|.:
  Fly   468 ILKPSI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 77/268 (29%)
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 40/208 (19%)
7tm_4 213..>385 CDD:304433 60/185 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I4416
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.