DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and Dh44-R1

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster


Alignment Length:452 Identity:97/452 - (21%)
Similarity:151/452 - (33%) Gaps:112/452 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 CLEHTQREGEVKIIACQHLFSSAAGAGIH-DGSIGGT-IEQANGQ-------------------- 325
            |...|.| |.:.::.|.....     ||| |.|...| ...|||.                    
  Fly    62 CWPRTAR-GTLAVLQCMDELQ-----GIHYDSSKNATRFCHANGTWEKYTNYDACAHLPAPESVP 120

  Fly   326 ------NLQKAVLTGGILVSIVFLSATLV--AGFL-LPAVHHALHWRCQICYVTCLLFGKILLAI 381
                  .|...:...|..:|:|.||..|:  |.|. |..:.:.:|......|:...||..:||::
  Fly   121 EFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIMSALFWILLLSV 185

  Fly   382 EELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWW----TFRDFRPSSLERNQEALRRY 442
            :   .|::.|..:|..|.....||.|..|||:......::.    ||          :.:.||..
  Fly   186 Q---ISIRSGVGSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTF----------SGDNLRFN 237

  Fly   443 LYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLYC-WFDNRNLSIFAYFYGPIGLLLCANIA 506
            :|:...||||.|.....|....| ..|...|...::.| |....::...  :.||:..:|..|:.
  Fly   238 IYASIGWGGPALFVVTWAVAKSL-TVTYSTPEKYEINCPWMQETHVDWI--YQGPVCAVLIINLT 299

  Fly   507 LFVSTTHQLTCGLWKRDDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHGVWFFTDLI 571
            ..:.....|...|...:.|::...:.| .:..|.|:.:.|:|::.     ::.||........:.
  Fly   300 FLLRIMWVLITKLRSANTVETRQYRKA-AKALLVLIPLFGITYLV-----VLAGPSESGLMGHMF 358

  Fly   572 NALQGVFI----FIVVGCQPQVWTACRRIFC-------PRLRHDITN---------------TTN 610
            ..|:.|.:    |.|           ...:|       ..|||.|:.               ||.
  Fly   359 AVLRAVLLSTQGFSV-----------SLFYCFLNSEVRNALRHHISTWRDTRTIQLNQNRRYTTK 412

  Fly   611 GVQHSSSSQGLPSM--------AGGTEITQNTTTTTTTTNTTA---THMPSNPAEDEVPEKA 661
            .......|....||        .|..|...::.||||.....|   .|..||.|...:|..|
  Fly   413 SFSKGGGSPRAESMRPLTSYYGRGKRESCVSSATTTTLVGQHAPLSLHRGSNNALHTMPTLA 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 57/257 (22%)
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 14/55 (25%)
7tmB1_DH_R 126..394 CDD:320391 65/300 (22%)
TM helix 1 129..153 CDD:320391 6/23 (26%)
TM helix 2 162..183 CDD:320391 4/20 (20%)
TM helix 3 197..219 CDD:320391 7/21 (33%)
TM helix 4 238..254 CDD:320391 6/15 (40%)
TM helix 5 279..302 CDD:320391 4/24 (17%)
TM helix 6 327..349 CDD:320391 5/26 (19%)
TM helix 7 356..381 CDD:320391 5/35 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.