DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and Dh44-R2

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster


Alignment Length:477 Identity:94/477 - (19%)
Similarity:155/477 - (32%) Gaps:151/477 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LPDCGQPGGYSIAGDWQDAKLDRNTAML---------QLPHKNLSAGQYCLEHTQRE-------- 290
            |.|..|.....:..::....|.|.:|::         ||.::.|.    |.:..|||        
  Fly    13 LDDASQEDLAKVIANFSVDMLQRASALIGAQQGSSGGQLQNRTLQ----CQQQQQREEEQASLEA 73

  Fly   291 ---GEVKIIACQHLFSSA-------AGA-----------GIH----------------------- 311
               |..:|:.|...|.|.       ||:           |:|                       
  Fly    74 LASGGKRILQCPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWDHYSDY 138

  Fly   312 ------DGSIGGTIEQANGQNLQKAVLTGGILVSIVFLSATLVAGFL----LPAVHHALHWRCQI 366
                  .|||....:.:....|...:..||..:|...|...|:. ||    |..:.:.:|....:
  Fly   139 DRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALII-FLSFKDLRCLRNTIHANLFL 202

  Fly   367 CYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFFW-------LNTMCFNIWWTF 424
            .|:|..|...:.|.::.:::  :...|.|.||.|..|:|:|..|||       |.|:   :..||
  Fly   203 TYITSALLWILTLFLQVITT--ESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTL---VVQTF 262

  Fly   425 RDFRPSSLERNQEALRRYLYSLYAWGGPLLITFVAACVDQLPETTLLRPGFG-------QLYC-W 481
                      :.:.:...:|:|..||.|      |.|:..........|...       ::.| |
  Fly   263 ----------SSDNISFIIYALIGWGCP------AVCILVWSIAKAFAPHLENEHFNGLEIDCAW 311

  Fly   482 FDNRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLWKRDDVKSSSEKSALGRVCLKLVVVMG 546
            .  |...|...|..|..|.|..|:...:.....|...|.....:::.....| .:..|.|:.:.|
  Fly   312 M--RESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLETRQYYKA-SKALLVLIPLFG 373

  Fly   547 VTWIADILSWLVGGPHGVWFFTDLINAL-------QGVFIFIVVGCQPQVWTACRRIFC------ 598
            :|:    |..|.|...|:  ..:|..|:       ||.|:.:              .:|      
  Fly   374 ITY----LLVLTGPEQGI--SRNLFEAIRAFLISTQGFFVAL--------------FYCFLNSEV 418

  Fly   599 -PRLRHDIT--NTTNGVQHSSS 617
             ..|||..|  ..:..:..:||
  Fly   419 RQTLRHGFTRWRESRNIHRNSS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 60/275 (22%)
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 7/61 (11%)
7tm_2 159..407 CDD:278432 61/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.