DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl1 and adgrg1

DIOPT Version :9

Sequence 1:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001018317.1 Gene:adgrg1 / 324948 ZFINID:ZDB-GENE-030131-3671 Length:648 Species:Danio rerio


Alignment Length:457 Identity:91/457 - (19%)
Similarity:153/457 - (33%) Gaps:140/457 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PNHQAAVDGLLRLSPQ------LPEGSYQTSYGLPDCGQPGGYSIAGD--------WQD-----A 261
            |:..|.:|.::.||.:      |.|......:..|......|..::.|        |:|     .
Zfish   270 PSKSALLDDIVGLSVENETIRNLIEPVKIRFHHRPFAPDSSGRCVSWDTKQDNEVNWKDDGCDTV 334

  Fly   262 KLDRNTAMLQLPHKNLSAGQYCLEHTQREGEVKIIACQHL----FSSAAGAGIHDGSIGGTI--- 319
            |::.........|....|   .|...:::..|:     ||    |.:|.|..:   |:...:   
Zfish   335 KINEEQTECHCNHLTYFA---ILVQVEQKSTVR-----HLKALTFITAVGCAV---SLVSCLVLF 388

  Fly   320 ----EQANGQNLQKAVLTGGILVSIVFLSATLVAGFLLPAVHHALHWRCQICYVTCLLFGKILLA 380
                ::..|:..|.:::..|::|:|..|....:...:|..|.:.         ..|.|.|.:|  
Zfish   389 YWLCKRRRGKKNQISLVHRGLVVAIFLLCLFFILTGILANVANE---------TVCQLTGSLL-- 442

  Fly   381 IEELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWWTFRDFRPSSLERN--QEALRRYL 443
                           |             :..|:|:|   |.....|....|.|.  ...|..::
Zfish   443 ---------------H-------------YGLLSTLC---WMAMEVFHTFLLVRKVFNSPLPIWI 476

  Fly   444 YSLYAWGGPLLITFVAACVDQLPETTLLRPG--FGQLY--CWFDNRNLSIFAYFYGPIGLLLCAN 504
            :.|..:|.|.|:..:...|..:.....::|.  ....|  ||....:.|..|::...||||    
Zfish   477 FYLMGFGFPFLLVSILLSVGDIYGERKIKPSDDVNNPYRMCWMTEGDKSQLAHYIINIGLL---- 537

  Fly   505 IALFVSTTHQLTCGL---------------WKRDDVKSSSEKSALGRVCLKLVVVMGVTWIADIL 554
             |:.||:      ||               ||:..|   :..|..|..||     .|.||   .|
Zfish   538 -AVVVSS------GLVMLFLVVREIRNRPDWKKIHV---AFLSIWGLTCL-----YGTTW---AL 584

  Fly   555 SWLVGGPHG--VWFFTDLINALQGVFIFIVVGCQPQVWTACRRIFCPRLRHDITNTTNGVQHSSS 617
            .:|..||..  ..|...:||:|||.|:.:            |.....|::....::::|....||
Zfish   585 GFLDFGPFSEVTLFLFCIINSLQGFFLML------------RYYALERMKKKDVSSSDGSSSGSS 637

  Fly   618 SQ 619
            .|
Zfish   638 KQ 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 59/272 (22%)
adgrg1NP_001018317.1 GPS 312..354 CDD:280071 6/44 (14%)
7tm_4 369..611 CDD:304433 65/308 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.